KEGG   Elusimicrobium minutum: Emin_1229Help
Entry
Emin_1229         CDS       T00741                                 

Definition
plp-dependent enzyme
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
emi  Elusimicrobium minutum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:emi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:emi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:emi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1329024..1330274)
Genome map
AA seq 416 aa AA seqDB search
MKKILNLQCINCGKEYKTSATDFLCLSCGSNLEVNYDYKLISKRFKIENFKDKKRFDMWR
YIDLLPVNDFDKLPYVQVGWTPMYDHKELADELGISKLLIKDEGRNPTGSIKDRGSAVSV
ARALELGLDIIADASTGNASDSLACLTAGLDIKTIVFTTKDAPYPKLTQLFVYGADVFTV
DGTYDDAFELCKKAVEEYGWYSRAAGYNPFTREGKKTCSFEICEQLNWEAPDKVLVAVGD
GTILSGMWKGFVDFQKLGILEKMPQMIAVQAEGSDAIKRAFENKGEVTAVKAHTIADSIL
VNYPRDAQLAVQALQESDGYAVTVTDEEILAAIPEFARKANIFAEPAGAAVYAALKKLAE
EGKIEQDETVAIVIGGNGLKDTYSYAKNIQKAEVISKDFEAFKITAKEKGLIKTDK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatactaaacttacaatgtataaattgcggtaaagaatataaaacaagcgca
acggactttctttgtttatcctgcgggagcaacctggaagtcaattatgattataagtta
atttctaaacgttttaaaatagagaattttaaagataaaaaacgctttgatatgtggcgt
tatatagatttgctgcccgttaacgattttgataaactgccctatgtgcaagtaggctgg
acgccgatgtacgaccacaaagaacttgcagatgaacttggtatatcaaaacttttaatt
aaggacgaaggacgcaaccccacaggttcaatcaaagaccgcggcagcgcggtgtctgtg
gcaagagctttggaacttggattagatataatagcggacgcttccacaggcaacgcaagt
gattctttggcctgtttaaccgccggtttagatattaaaacaattgtttttacaaccaaa
gatgcgccgtatcccaaacttactcagctttttgtgtatggggcggatgtctttaccgta
gacggcacttatgacgatgcttttgagctttgcaaaaaagcggttgaagaatacggctgg
tattccagggcggcggggtataatccttttacaagggaaggcaagaaaacatgctcgttt
gaaatatgcgagcagctcaactgggaagccccggataaagtgcttgtcgccgtgggcgat
gggactattttaagcggtatgtggaaaggttttgttgattttcaaaaacttggtattttg
gaaaaaatgccgcaaatgatagctgtgcaagcagaaggcagcgacgctataaaaagagct
tttgaaaacaaaggcgaggttaccgccgttaaagcgcatacgatagctgacagtatttta
gttaattacccgcgtgacgcgcagcttgcggttcaggctttgcaggaatcagacgggtac
gccgttacggtaacggatgaagaaatacttgccgctatacccgagtttgccagaaaggcc
aacatttttgccgaaccggcgggcgcggctgtttacgccgctcttaaaaaattagcggag
gaaggtaaaatagaacaggatgaaaccgttgctattgttataggcggcaacggacttaaa
gacacgtattcttacgctaaaaacatacagaaagcggaagtaatttcaaaagattttgaa
gcatttaaaataacggccaaagaaaaagggcttataaaaacagataaataa

DBGET integrated database retrieval system