KEGG   Elusimicrobium minutum: Emin_1229Help
Entry
Emin_1229         CDS       T00741                                 

Definition
(RefSeq) plp-dependent enzyme
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
emi  Elusimicrobium minutum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emin_1229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emin_1229
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Emin_1229
Enzymes [BR:emi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Emin_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1329024..1330274)
Genome map
AA seq 416 aa AA seqDB search
MKKILNLQCINCGKEYKTSATDFLCLSCGSNLEVNYDYKLISKRFKIENFKDKKRFDMWR
YIDLLPVNDFDKLPYVQVGWTPMYDHKELADELGISKLLIKDEGRNPTGSIKDRGSAVSV
ARALELGLDIIADASTGNASDSLACLTAGLDIKTIVFTTKDAPYPKLTQLFVYGADVFTV
DGTYDDAFELCKKAVEEYGWYSRAAGYNPFTREGKKTCSFEICEQLNWEAPDKVLVAVGD
GTILSGMWKGFVDFQKLGILEKMPQMIAVQAEGSDAIKRAFENKGEVTAVKAHTIADSIL
VNYPRDAQLAVQALQESDGYAVTVTDEEILAAIPEFARKANIFAEPAGAAVYAALKKLAE
EGKIEQDETVAIVIGGNGLKDTYSYAKNIQKAEVISKDFEAFKITAKEKGLIKTDK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatactaaacttacaatgtataaattgcggtaaagaatataaaacaagcgca
acggactttctttgtttatcctgcgggagcaacctggaagtcaattatgattataagtta
atttctaaacgttttaaaatagagaattttaaagataaaaaacgctttgatatgtggcgt
tatatagatttgctgcccgttaacgattttgataaactgccctatgtgcaagtaggctgg
acgccgatgtacgaccacaaagaacttgcagatgaacttggtatatcaaaacttttaatt
aaggacgaaggacgcaaccccacaggttcaatcaaagaccgcggcagcgcggtgtctgtg
gcaagagctttggaacttggattagatataatagcggacgcttccacaggcaacgcaagt
gattctttggcctgtttaaccgccggtttagatattaaaacaattgtttttacaaccaaa
gatgcgccgtatcccaaacttactcagctttttgtgtatggggcggatgtctttaccgta
gacggcacttatgacgatgcttttgagctttgcaaaaaagcggttgaagaatacggctgg
tattccagggcggcggggtataatccttttacaagggaaggcaagaaaacatgctcgttt
gaaatatgcgagcagctcaactgggaagccccggataaagtgcttgtcgccgtgggcgat
gggactattttaagcggtatgtggaaaggttttgttgattttcaaaaacttggtattttg
gaaaaaatgccgcaaatgatagctgtgcaagcagaaggcagcgacgctataaaaagagct
tttgaaaacaaaggcgaggttaccgccgttaaagcgcatacgatagctgacagtatttta
gttaattacccgcgtgacgcgcagcttgcggttcaggctttgcaggaatcagacgggtac
gccgttacggtaacggatgaagaaatacttgccgctatacccgagtttgccagaaaggcc
aacatttttgccgaaccggcgggcgcggctgtttacgccgctcttaaaaaattagcggag
gaaggtaaaatagaacaggatgaaaccgttgctattgttataggcggcaacggacttaaa
gacacgtattcttacgctaaaaacatacagaaagcggaagtaatttcaaaagattttgaa
gcatttaaaataacggccaaagaaaaagggcttataaaaacagataaataa

DBGET integrated database retrieval system