KEGG   Elusimicrobium minutum: Emin_1381Help
Entry
Emin_1381         CDS       T00741                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
emi  Elusimicrobium minutum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:emi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:emi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1483342..1484154
Genome map
AA seq 270 aa AA seqDB search
MRQNISKKMFQKAEIIVFKVGSSLIVDSDGETRDYWIDSLAEDIRDLACLGKKSVIVSSG
AIALGRKILGFGVNDKLTLSQKQAAAAVGQIKLCELYRNILKIKRIKTAQVLLTRENANN
EKTFLNATNTLNALLAMNVVPIINENDTISTEEIRFGDNDKLSALVSQMVDADILVLLSD
IDGLYTNDPKISKKAKFVPLVKEINENIEKMAAPTKSALGTGGMASKICAAKMCVAADCS
MVITTGAELYPVRRLIQKGRCTWFVPGDTK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaacatatctaaaaaaatgttccaaaaagccgaaataatagtttttaaagta
gggtcgtcattaatagttgactcggacggagaaaccagagactattggatagacagcctt
gccgaggatataagagatttggcgtgtttgggtaaaaaatcggttatagtttcctccggc
gctatagctttgggccgcaaaattttggggtttggcgtaaatgacaaattaaccttaagc
caaaaacaggccgcagccgccgtagggcagattaagctttgcgaactttacagaaatatt
ttgaaaataaagagaataaaaaccgcgcaagttttacttacccgggaaaacgccaataat
gaaaaaacctttttaaacgccacaaacaccttaaacgcgcttttggctatgaatgtagtg
cctataataaacgaaaacgatactatttcaacagaagaaatacgttttggcgacaatgac
aaactaagcgccttagtatcgcaaatggtcgacgccgacattttggttttgctttcggat
atagacggtctttataccaatgatcctaaaatatctaaaaaagctaaatttgttcctctg
gtaaaagaaataaatgaaaatattgaaaaaatggccgcgcctacaaaatccgccttggga
acgggcggcatggccagcaaaatttgcgccgctaaaatgtgtgtagccgcggattgcagc
atggtcataacaaccggggcggaattatatcctgtacggagattaatacaaaaaggacga
tgcacatggtttgtgccgggtgatacaaaatga

DBGET integrated database retrieval system