KEGG   Elusimicrobium minutum: Emin_1469Help
Entry
Emin_1469         CDS       T00741                                 

Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
emi  Elusimicrobium minutum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:emi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Emin_1469
DNA repair and recombination proteins [BR:emi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Emin_1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1565927..1566520
Genome map
AA seq 197 aa AA seqDB search
MKSFDRLVRALRRLPGVGPRQAERFSAYFLKTSDSEIDEFINALSALRENIHLCSICFAY
SEDGVCDICEDSSRERDIICVVEDPQDIEAIEKTGAFKGLYHVLHGALSPIDGRGVENIK
IRELIERIHNSQTPVREVIIATDPDTEGETTALYIADALRGLVDKVSRIGYGVPLGGDLD
YLDEMTLTYSLKGRTKL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttttgaccgtcttgtacgcgctttaaggcgtttgcccggcgtaggccccaga
caggcggagcgcttttccgcttattttttaaaaaccagcgacagtgaaattgacgagttt
attaacgctttatccgctcttcgtgaaaatattcatctttgttcaatttgttttgcctat
tcggaagacggggtttgcgatatttgtgaggattcttcccgcgagcgtgatatcatttgc
gtagttgaagacccgcaagacattgaagctattgaaaaaacaggcgcatttaaaggcctg
tatcatgtgctgcacggcgcgctgtcacccatagatggccgtggcgttgaaaatataaaa
ataagagaacttattgaacgcatacataattcccaaacacctgtgagagaggttattata
gctaccgaccctgacactgaaggagaaaccaccgccctttatattgccgacgctttaaga
ggacttgttgataaagtttcccgcataggttacggcgttcctttaggcggcgatttggat
tatttagacgaaatgactttaacctattctttaaaaggcagaacaaaactataa

DBGET integrated database retrieval system