KEGG   Elusimicrobium minutum: Emin_1538Help
Entry
Emin_1538         CDS       T00741                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
emi  Elusimicrobium minutum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Emin_1538
Enzymes [BR:emi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Emin_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1632360..1633229
Genome map
AA seq 289 aa AA seqDB search
MKKNKTIFMGLERKNNSLPLSNYIVVPIPFERSVSYGHGTAFGPKAVLEASAQVELWDEE
TKTETWKENIFTTAAVNCKGTTRIVFNRITKTVKDVMRYKGIPFYIGGEHSITQALLEPY
IEKYKKLSVLHFDAHADLRAKFEGNPHSHACALYPASKQVPVVQVGIRSVGDTECENINS
GKVKTFLMHENRDIKKLIPQVLKNLTDTVYITIDVDGFDPSVIPATGTPQPGGFGWYEAL
DLFREVINKKNIVAIDVVEACRRDEDTITEMNTAKLIYRLMGYLSQKKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagaataaaactatatttatggggcttgagagaaaaaacaactctctgcccctt
tctaattacatcgtggtgcccataccttttgaaagaagcgtttcctacggacatggcacc
gcattcgggccgaaggctgttttagaagcttccgcccaggtggaactttgggacgaggaa
actaaaacggaaacctggaaagagaacatctttaccaccgctgcggttaactgcaaagga
accacaagaattgtttttaacagaattacaaaaaccgttaaagacgttatgcgctataaa
gggattcctttttatatcggcggggaacattctataactcaggccttgcttgaaccgtat
atagaaaaatataaaaaattaagcgtgctccattttgacgcccacgctgatttacgcgcc
aagtttgaaggaaatccacacagccacgcctgcgcgctttaccccgcgtccaaacaagtg
cccgtcgtacaagtaggcataagaagcgttggcgacacggagtgtgaaaatataaattcc
ggcaaagttaaaacttttttaatgcatgaaaacagggatataaaaaaacttattccacag
gtactaaaaaatttaaccgacacggtttatatcaccattgacgtggatggctttgaccca
agcgtaattcctgccacgggaacgccgcagccgggcggtttcggatggtatgaagcgtta
gatctttttagagaagtaattaacaagaaaaacattgtagccattgacgttgtggaagcc
tgcagaagagacgaagacaccattaccgaaatgaataccgcaaaacttatttaccgctta
atgggttatttaagccaaaagaaaaaataa

DBGET integrated database retrieval system