KEGG   Enterococcus mundtii: EMQU_1144Help
Entry
EMQU_1144         CDS       T02931                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
emu  Enterococcus mundtii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:emu01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:emu01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:emu00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:emu00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199346..1200563
Genome map
AA seq 405 aa AA seqDB search
MREFEKSNKLEGVSYDVRGPVLEEAERMQEEGISILKLNTGNPAPFGFEAPNEVIRDLIM
NARDSEGYSDSKGIFSARKAIEQYCQLKKFPNVTINDIYTGNGVSELITMCMQGLLDNGD
EVLVPMPDYPLWTASVSLAGGKPVHYVCDEQAEWYPDIEDIKSKVTSRTKAIVIINPNNP
TGALYPKELLEEIVKIAREHQLIIYSDEIYDRLVMDGLEHIPIATLAPDLFVVTLNGLSK
SHRVAGFRVGWMVLSGDKSNVKGYIEGLNMLSSMRLCSNVLSQQIIQTALGGYQSVDELL
LPGGRIYEQREYIYNAINDIPGLSAVKPKAAFYIFPKIDTKRFNITNDEQFVLDFLHEHK
ILLVHGGGFNWPDPDHFRIVYLPKLDDLKVTAKKMREFLTTYRQR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatttgaaaaatccaacaaattagaaggcgtaagttacgatgtccgcggaccg
gttcttgaagaagcagaacgaatgcaagaagagggcatcagtatattaaaattgaatacg
ggaaatccagcaccatttggatttgaggcaccaaatgaagtgatccgtgatttgatcatg
aatgccagagattcagaaggctattcggattcaaaagggattttttctgcacgaaaagcg
attgaacagtattgtcaattgaaaaaatttccaaatgtgacgatcaatgatatctatact
ggtaatggggtcagtgagctgatcacgatgtgtatgcaagggctgttggacaatggcgat
gaagtattagtgccaatgccggattatcctttatggacagcttctgtttctttggctgga
ggaaaaccagttcattatgtatgcgatgaacaagccgaatggtatccagatattgaggat
atcaaatctaaagttaccagccggacaaaggcaatcgtgatcatcaatcctaataatcca
acaggagctttatatccgaaagaattattagaagaaatcgtgaaaatcgcacgagaacat
caattgatcatttattcagacgaaatctatgatcgtttagtgatggatggcttagagcat
atcccgattgcgactttagcacctgatctattcgttgtcacattgaatggcctatctaaa
tcacatcgtgtggcgggattccgtgtcggctggatggtgttgagtggtgacaaatcaaat
gtaaaaggctatatcgaagggttgaatatgctttcctctatgcgtctttgttcaaatgtt
ctgtcacaacaaatcatccaaactgccctagggggctaccaaagtgtggatgaattgcta
ttgccaggtggacggatctacgaacaaagagaatacatttataatgcaatcaatgatatc
cctggattatcagcggttaagccgaaagcagctttttatatctttccaaaaatcgatacg
aaacgcttcaatattaccaatgatgagcagttcgtattagattttctgcacgagcataag
attttacttgttcacggaggcggttttaactggcctgatccagaccacttcagaatcgtt
tacttaccaaaattagacgatctaaaagtaacggcgaaaaaaatgcgtgaattcctgaca
acctaccgacaaagatag

DBGET integrated database retrieval system