KEGG   Enterococcus mundtii: EMQU_1996Help
Entry
EMQU_1996         CDS       T02931                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
emu  Enterococcus mundtii
Brite
Enzymes [BR:emu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     EMQU_1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 DLH Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DUF2048 BAAT_C Coprogen_oxidas
Motif
Other DBs
NCBI-ProteinID: BAO07553
UniProt: V5XR64
Position
complement(2083425..2084171)
Genome map
AA seq 248 aa AA seqDB search
MKSLPQPIYEKHGKRAILLLHAYSGSPNDVRMLARFLEKSNYSVYAPMFTGHGTLAPNEI
LEQDAETWWQDTKQAIKFLNDEGFSDIAVLGLSMGGIFAVRALSEFPMIGGGFFCSPISP
VENHVPENFENYVRQVLKIAGESESMIEQKVESFRPRVQQQLIDIQEQAAITESKLSDIQ
KPVFMAQAGQDEMIDPYGVYETAKKLTQTDISLHWYPESKHVITVGIARKAFEKDVLDFL
ENLPWNEE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtctaccacaacctatttatgaaaaacatgggaagcgtgcaatcctcttattg
catgcgtattcaggtagtccaaatgatgtacggatgttagcccgttttttagagaaatca
aactattcggtctatgccccaatgtttacaggacatggcacgcttgctccaaatgagatc
ttagaacaggacgctgagacgtggtggcaagacacgaaacaagcgatcaagtttctcaac
gatgaaggattttctgacatcgccgtattaggattgtcgatgggtggcatttttgccgtt
cgagcattatcagaatttccgatgataggaggcggatttttttgttcgccaatttctcca
gtagaaaatcatgtgccggagaattttgagaattatgtacgccaggtcttgaaaattgcc
ggtgaatcggagtcgatgatcgaacaaaaagtcgaaagctttcggccacgagtacagcaa
caattaatagatattcaagagcaagcagcaataacagaaagtaagttatcagatatccaa
aaaccagtattcatggctcaagcgggtcaagatgaaatgattgatccttatggtgtctac
gagacagcaaaaaaacttacgcaaactgacatttccttacactggtatccagaaagtaag
catgtgatcacagtaggaatagcaagaaaagcgtttgaaaaggatgtactggattttcta
gagaacttaccttggaatgaggaataa

DBGET integrated database retrieval system