KEGG   Enterococcus mundtii: EMQU_1996Help
Entry
EMQU_1996         CDS       T02931                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
emu  Enterococcus mundtii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2083425..2084171)
Genome map
AA seq 248 aa AA seqDB search
MKSLPQPIYEKHGKRAILLLHAYSGSPNDVRMLARFLEKSNYSVYAPMFTGHGTLAPNEI
LEQDAETWWQDTKQAIKFLNDEGFSDIAVLGLSMGGIFAVRALSEFPMIGGGFFCSPISP
VENHVPENFENYVRQVLKIAGESESMIEQKVESFRPRVQQQLIDIQEQAAITESKLSDIQ
KPVFMAQAGQDEMIDPYGVYETAKKLTQTDISLHWYPESKHVITVGIARKAFEKDVLDFL
ENLPWNEE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtctaccacaacctatttatgaaaaacatgggaagcgtgcaatcctcttattg
catgcgtattcaggtagtccaaatgatgtacggatgttagcccgttttttagagaaatca
aactattcggtctatgccccaatgtttacaggacatggcacgcttgctccaaatgagatc
ttagaacaggacgctgagacgtggtggcaagacacgaaacaagcgatcaagtttctcaac
gatgaaggattttctgacatcgccgtattaggattgtcgatgggtggcatttttgccgtt
cgagcattatcagaatttccgatgataggaggcggatttttttgttcgccaatttctcca
gtagaaaatcatgtgccggagaattttgagaattatgtacgccaggtcttgaaaattgcc
ggtgaatcggagtcgatgatcgaacaaaaagtcgaaagctttcggccacgagtacagcaa
caattaatagatattcaagagcaagcagcaataacagaaagtaagttatcagatatccaa
aaaccagtattcatggctcaagcgggtcaagatgaaatgattgatccttatggtgtctac
gagacagcaaaaaaacttacgcaaactgacatttccttacactggtatccagaaagtaag
catgtgatcacagtaggaatagcaagaaaagcgtttgaaaaggatgtactggattttcta
gagaacttaccttggaatgaggaataa

DBGET integrated database retrieval system