KEGG   Enterococcus mundtii: EMQU_2383Help
Entry
EMQU_2383         CDS       T02931                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
emu  Enterococcus mundtii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:emu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EMQU_2383
Enzymes [BR:emu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EMQU_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2453941..2454849)
Genome map
AA seq 302 aa AA seqDB search
MNTVTVIGSINLDRTIRVTYMPKPGETIHTKETFSAGGGKGANQAVAARRSEAKTYFIGG
VGKDEAGKTMTELLEQEEIDLSGVATLENQATGQAYIIVDDQGENSIMIHAGANNAFTVA
QVQENKTIIQKSDFIIAQFESAIEPTIEAFKIAREAGVKTILNPAPALENVPDELLAVTD
MIIPNETETEILTGITITDEKSLKEAAQVFHGLGIEAVIITIGSKGAYYDIADGASGIVP
AFKVHAVDTTAAGDTFIGAMSSVLAKDFSNLEEAIRYGNKASSVTVQRFGAQPSIPYKHE
LI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgttacagttatcggaagcatcaatttagatcgaaccatccgtgtgacttat
atgccaaaacctggagaaacgatccatacgaaagaaactttttcagctggtggaggaaag
ggagccaaccaagcggttgctgctagacgttcggaggcaaaaacttactttattggtggc
gtgggtaaagacgaagcaggaaaaacgatgacagaattacttgaacaagaagaaattgat
ttatctggtgtagcgacattagaaaatcaagcgactggacaagcgtatatcattgttgat
gaccaaggtgaaaatagtatcatgatccatgctggtgcaaacaatgcgtttaccgtagca
caagtacaagaaaataaaacaatcatccaaaaaagtgattttattattgctcagtttgaa
agcgctatagaaccgacgatcgaagcattcaaaatcgctcgagaagctggcgtgaaaacg
atcttgaatccggcaccggcgctagaaaatgttcctgacgagttattagcagtaacggat
atgatcattccaaatgaaacagaaacggagatcttaacaggcattactattaccgatgaa
aaaagtctaaaagaggcggcacaagtctttcatggattaggtattgaagcggtgatcatc
acgatcggaagtaaaggcgcttattatgatattgctgacggcgctagtgggatcgtacca
gcttttaaagtccatgcagtagatacaacggctgctggggatacctttattggcgcgatg
agcagtgtattagccaaagacttcagtaacctagaagaagcaatccgctatggtaataaa
gcctcttctgtgactgttcaacgttttggtgcacagccttctattccgtataaacatgaa
ttaatctga

DBGET integrated database retrieval system