KEGG   Enterococcus mundtii: EMQU_2644Help
Entry
EMQU_2644         CDS       T02931                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
emu  Enterococcus mundtii
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EMQU_2644
   00500 Starch and sucrose metabolism
    EMQU_2644
Enzymes [BR:emu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     EMQU_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2717549..2718454)
Genome map
AA seq 301 aa AA seqDB search
MKTEIVIDPIPRKADYQTIQAGIAHLSSLPNYVKKTMIIREGVYHEYIECRLSNFQMFGQ
GEVKIVGCRFAKQTLSSGEARETFRTATLFLEGENIRLENIQIINNAGAGEQVGQAVALF
NYAHQVQLINCRLCGQQDTLCTGPLPPIQKDGRPFFTPVLKERKYCRQSYERCWIEGTVD
FIFGGADALFYRCFIHSLVSSSNGYITAASTVKEQERGFLFFRCAIIADYEAPSIYLGRP
WRPYAQVTFEECDVGAHVYQSGWHDWDEKQNRQTARFYEKNNRYQRGICRESWVTVETEV
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagaaatcgtgatcgacccgattccaagaaaagcagactatcagaccattcaa
gcaggaattgctcatcttagctcattgccgaattacgtaaaaaagaccatgatcattcga
gaaggggtctatcatgaatatatcgaatgtcggctgtcaaatttccaaatgtttggacaa
ggagaagtaaagattgttggatgccgttttgcgaaacaaacactttcatctggtgaagca
agagaaacatttcgaaccgcgacactatttcttgaaggagaaaatattcgtctcgaaaat
atacaaatcatcaataacgctggtgcaggagaacaagtaggtcaagcagtcgcgctattc
aattatgcccatcaagtccagttgatcaattgtcggttgtgcgggcaacaagatacatta
tgcacaggaccgttgcctccgattcaaaaagatggtcgcccattttttaccccagtgtta
aaggagcgtaagtattgtcggcaatcttatgaacgatgttggatcgaagggacggtggac
tttattttcggtggggcagatgcgttgttttaccgctgtttcatccacagtttggttagt
tcttctaatggttatatcacagccgcttcaacggtaaaagaacaagaacgaggttttctt
ttttttaggtgtgcaatcatcgcagattacgaggcaccttctatctatttaggtcgacct
tggcgtccgtatgctcaggtgacatttgaagagtgtgatgtaggagcgcatgtctaccaa
agtggctggcatgactgggatgagaaacaaaacagacaaacagcacgcttttatgaaaaa
aataataggtatcaaaggggaatttgtcgcgaatcatgggttactgtggaaacggaggtc
gattag

DBGET integrated database retrieval system