KEGG   Escherichia coli NA114: ECNA114_0036Help
Entry
ECNA114_0036      CDS       T01998                                 

Gene name
folA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ena  Escherichia coli NA114
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ena00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ena00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
38973..39563
Genome map
AA seq 196 aa AA seqDB search
MDSPAEYKIFLNIILAPVDDGLRFTYSGDNFFYREISMISLIAALAVDRVIGMENAMPWN
LPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIA
ACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDA
DAQNSHSYCFEILERR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtggactcgccagcagaatataaaattttcctcaacatcatcctcgcaccagtcgacgac
ggtttacgctttacgtatagtggcgacaattttttttatcgggaaatctcaatgatcagt
ctgattgcggcgttagcggtagatcgcgttatcggcatggaaaacgccatgccgtggaac
ctgcctgccgatctcgcctggtttaaacgcaacactttaaataaacccgtgattatgggc
cgccatacctgggaatccatcggtcgtccgttgccaggacgcaaaaatattatcctcagc
agtcaaccgggtacggacgatcgcgtaacgtgggtgaagtcggtggatgaagccattgcg
gcgtgtggtgacgtaccagaaatcatggtgattggcggcggtcgcgtttatgagcagttc
ctgccgaaagcgcaaaaactgtatctgacgcatatcgacgcggaagtggaaggcgacacc
catttcccggattacgagccggatgactgggaatcggtattcagtgaattccacgacgcc
gatgcgcagaactctcacagctattgctttgagattctggagcggcggtaa

DBGET integrated database retrieval system