KEGG   Escherichia coli NA114 (UPEC): ECNA114_0334Help
Entry
ECNA114_0334      CDS       T01998                                 

Gene name
mhpF
Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00360  Phenylalanine metabolism
ena00362  Benzoate degradation
ena00620  Pyruvate metabolism
ena00621  Dioxin degradation
ena00622  Xylene degradation
ena00650  Butanoate metabolism
ena01100  Metabolic pathways
ena01120  Microbial metabolism in diverse environments
ena01220  Degradation of aromatic compounds
Module
ena_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNA114_0334 (mhpF)
   00650 Butanoate metabolism
    ECNA114_0334 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECNA114_0334 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNA114_0334 (mhpF)
   00622 Xylene degradation
    ECNA114_0334 (mhpF)
   00621 Dioxin degradation
    ECNA114_0334 (mhpF)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECNA114_0334 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEG35156
Position
375919..376869
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEEN
VAQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttcaggcaacattggcaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcg
ggcgcgcatgtgaaaaacgatgccgctttgcgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggagaac
gtcgctcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggta
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctattgccagt
aaatctgccggacccggcacgcgtgccaacatcgatgaatttacggaaaccacttcgcgc
gccattgaagtggtgggtggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagtcatcccgcaggataaaccggtcaatttaccg
ggcgtggggcagttctccgggctgaaaacggcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system