KEGG   Escherichia coli NA114 (UPEC): ECNA114_0685Help
Entry
ECNA114_0685      CDS       T01998                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00010  Glycolysis / Gluconeogenesis
ena00260  Glycine, serine and threonine metabolism
ena00680  Methane metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01130  Biosynthesis of antibiotics
ena01200  Carbon metabolism
ena01230  Biosynthesis of amino acids
Module
ena_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ena_M00002  Glycolysis, core module involving three-carbon compounds
ena_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_0685 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ECNA114_0685 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECNA114_0685 (gpmA)
Enzymes [BR:ena01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECNA114_0685 (gpmA)
Membrane trafficking [BR:ena04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECNA114_0685 (gpmA)
Exosome [BR:ena04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECNA114_0685 (gpmA)
  Exosomal proteins of melanoma cells
   ECNA114_0685 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AEG35507
Structure
PDB: 

Jmol
Position
complement(746798..747550)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctattcataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcattgcagggtctgaacaaa
gcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgcg
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagagctgccactgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtcatc
atcgccgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system