KEGG   Escherichia coli NA114: ECNA114_1247Help
Entry
ECNA114_1247      CDS       T01998                                 

Definition
Putative phage endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ena  Escherichia coli NA114
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1266487..1267020
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIAAGAPAPDILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDG
KPVVPGMKLSKEKCDRVNAIERDKALAWVEKNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVFRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcgctgattgccgctggt
gcgcctgcgcctgacattctcgaccagtttctggatgaaaaggaaggtaaccacaccacg
gcataccgtgatggcgcgggtatctggaccatctgccgcggtgccatcctggtggatggc
aaacctgtcgttccgggcatgaagttgtcgaaggaaaaatgcgaccgggttaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcaaagtgccattgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttacagacgaattaatgcaggtgatcgcaggggagcatgcgaagcgattcgc
tggtggattaaggacggtggcagagactgccgtattcgctcaaataactgttacggtcag
gtattccgtcgtgaccaggagagcgcgctggcgtgctggggaatcgacagataa

DBGET integrated database retrieval system