KEGG   Escherichia coli NA114 (UPEC): ECNA114_1449Help
Entry
ECNA114_1449      CDS       T01998                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00260  Glycine, serine and threonine metabolism
ena00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01130  Biosynthesis of antibiotics
ena01230  Biosynthesis of amino acids
Module
ena_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECNA114_1449 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECNA114_1449 (trpB)
Enzymes [BR:ena01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECNA114_1449 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEG36274
Structure
PDB: 

Jmol
Position
complement(1447914..1449107)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcccgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtactcggtcaggctttactggcgaagcgg
atgggtaaaactgaaattattgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgttttccggatgcgcttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgaccctgaaagatgcctgtaatgaggcgctacgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggtaccgcagctggcccgcatccttacccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaacgaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggtggttcgaatgccatcggtatg
tttgcagatttcatcaacgaaaccgacgtcggcctgattggtgtggagcctggcggtcac
ggtatcgaaactggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcaaattgaagagtcttactccatt
tctgccgggctggatttcccgtccgtcggcccgcaacatgcgtatctcaacagcactgga
cgcgctgattacgtgtctattaccgacgatgaagccctggaagcctttaaaacgctttgc
ctgcatgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaatccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system