KEGG   Escherichia coli NA114: ECNA114_1450Help
Entry
ECNA114_1450      CDS       T01998                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase/Phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ena  Escherichia coli NA114
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ena01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ena00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1449119..1450477)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDTLREALPAHVAIWKALS
VGETLPARDFQHIDKYVFDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcagcaaccgctggccagttttcagaatgagattcagccgagcacgcgacatttttat
gatgcgctacagggtgcacgcacggcgtttattctggagtgcaaaaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccggcacgcattgctgccatttataaacattac
gcttcggcaatttcagtgctgactgatgagaaatattttcaggggagctttgatttcctc
cccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgatcct
taccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttcagta
ctggatgacgaacaatatcgccagcttgcagccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgcgatttgtcgattgatctcaaccgtacccgcgag
cttgcaccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggctttctgattggttcggcgttgatg
gcccatgacgatttgaacgccgctgtgcgtcgggtgttgctgggtgagaataaagtatgt
ggcctgacacgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggtggg
ttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagatcagctg
tatatcgacactctgcgtgaggctctgccagcacacgtcgccatctggaaggctttaagt
gtcggtgaaactcttcccgcgcgcgattttcagcacatcgataaatatgtattcgacaac
ggtcagggcgggagcggacaacgtttcgactggtcactattaaatggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccgggcttgattttaattctgctgtagagtcgcaaccgggtatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system