KEGG   Escherichia coli NA114: ECNA114_1826Help
Entry
ECNA114_1826      CDS       T01998                                 

Gene name
yeaD
Definition
Putative aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ena  Escherichia coli NA114
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_1826 (yeaD)
Enzymes [BR:ena01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ECNA114_1826 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1837337..1838221
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGIPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDADGVALTFE
LTQSEETKKFWPHDFTLLAHFHVGKTCEIDLEAHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcgggtgaagaagaagttctgtgg
ttgagtaacaacacaccgttcaaaaatggcgtcgccattcgcggtggcataccggtttgc
tggccgtggtttggtccggctgcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctgatggtgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggccgcacgactttacgctgttagcgcat
ttccacgtgggtaaaacctgtgaaatcgatcttgaagcacacggcgaatttgaaactacc
tctgctctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtggacta
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtaatt
aatgacgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccaggaccggcgctttcagttagcatgggcgatatgccggatgatggctac
aagacctttgtttgtgtagaaacggcttacgcttcagaaacgcaaaaagtcaccaaagag
aaacctgcacatctggcgcaatccattcgtgttgctaaacgttaa

DBGET integrated database retrieval system