KEGG   Escherichia coli NA114 (UPEC): ECNA114_1826Help
Entry
ECNA114_1826      CDS       T01998                                 

Gene name
yeaD
Definition
(GenBank) Putative aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00010  Glycolysis / Gluconeogenesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_1826 (yeaD)
Enzymes [BR:ena01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ECNA114_1826 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEG36654
Position
1837337..1838221
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGIPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDADGVALTFE
LTQSEETKKFWPHDFTLLAHFHVGKTCEIDLEAHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcgggtgaagaagaagttctgtgg
ttgagtaacaacacaccgttcaaaaatggcgtcgccattcgcggtggcataccggtttgc
tggccgtggtttggtccggctgcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctgatggtgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggccgcacgactttacgctgttagcgcat
ttccacgtgggtaaaacctgtgaaatcgatcttgaagcacacggcgaatttgaaactacc
tctgctctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtggacta
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtaatt
aatgacgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccaggaccggcgctttcagttagcatgggcgatatgccggatgatggctac
aagacctttgtttgtgtagaaacggcttacgcttcagaaacgcaaaaagtcaccaaagag
aaacctgcacatctggcgcaatccattcgtgttgctaaacgttaa

DBGET integrated database retrieval system