KEGG   Escherichia coli NA114: ECNA114_2935Help
Entry
ECNA114_2935      CDS       T01998                                 

Gene name
dsbC
Definition
Thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ena  Escherichia coli NA114
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3023412..3024122)
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFVQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKDMKEFLDEHQKMTSGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttatttaccttgttggcagcgttttcaggctttgttcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcatcaaaagcagcgatattcag
cccgcgcccgtagctggcatgaagacagttctgactaacagcggtgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagtggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtggttac
tgccacaaactgcatgagcaaatggcagactataacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggacagcgatgcagagaaagaaatgaaagctatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggcaggtaaaagcgtcgcacca
gccagctgcgacgtagatattgccgaccattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gacatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaaataa

DBGET integrated database retrieval system