KEGG   Escherichia coli NA114: ECNA114_2944Help
Entry
ECNA114_2944      CDS       T01998                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ena  Escherichia coli NA114
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_2944 (bglA)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECNA114_2944 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3028843..3030282
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVVPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMIDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAHRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQKSMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagttgtgcctggcaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaggaggacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacttccatcgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgatcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatatggtagctggaccaaccgtaaagtggttgatttctttgtccgtttc
gcggaagtggtattcgaacgctataagcacaaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgaacatgaaaacccggaagagaccatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagccgcgcatcgcatcaacccggagatgaaagtcggttgt
atgctggcgatggtgccgctctatccctactcctgtaacccggacgatgtgatgtttgcc
cagaagtcgatgcgcgaacgttacgtctttaccgatgtgcagttgcgtggctattacccg
tcctatgtgttgaacgagtgggaacgccgcggatttaacatcaaaatggaagacggcgat
ctggatgtactgcgcgaaggcacctgcgattatctcggcttcagctattacatgaccaac
gcggtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccggttggtctgcgttac
gcgctttgcgagctgtatgagcgttaccagaagccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagatgatggcagcatcaatgacgattaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcgttcactaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaatttgtaa

DBGET integrated database retrieval system