KEGG   Escherichia coli NA114: ECNA114_3256Help
Entry
ECNA114_3256      CDS       T01998                                 

Gene name
folP
Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ena  Escherichia coli NA114
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ena00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3341402..3342250)
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLLDAVKHANLMINAGATIIDVGGE
STRPGAAEVCVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctttgcccagggtacttcactggaccttagccatcctcacgtaatggggatc
ctcaacgtcacgcctgattccttttcggatggtggcacgcataactcgctgttagatgcg
gtgaaacatgcgaatctgatgatcaacgctggcgcgacgatcattgacgttggtggcgag
tccacgcgcccaggggcggcggaagtttgcgttgaagaagagttgcaacgtgttattcct
gtggttgaggcaattgctcaacgcttcgaagtctggatctcggtagatacatccaaacca
gaagtcatccgtgagtcagcgaaagttggcgctcacattattaacgatatccgctccctt
tccgaacctggtgctctggaggcggctgcagaaaccggtttaccggtttgtctgatgcat
atgcagggaaatccaaaaaccatgcaggaagcgccgaagtatgacgatgtctttgcagaa
gtgaatcgctactttattgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagag
aaattgttgctcgaccccggattcggtttcggtaaaaatctctcccataactattcatta
ctggcgcgcctggctgaatttcaccatttcaacctgccgctgttggtgggtatgtcacga
aaatcgatgattgggcaattgctgaacgtggggccgtccgagcgcctgagcggtagtctg
gcctgtgcggtcattgccgcaatgcaaggcgcgcacatcattcgtgttcatgacgtcaaa
gaaaccgtagaagcgatgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system