KEGG   Escherichia coli NA114 (UPEC): ECNA114_3680Help
Entry
ECNA114_3680      CDS       T01998                                 

Gene name
yhjM
Definition
(GenBank) Endoglucanase precursor protein (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3774245..3775321)
Genome map
AA seq 358 aa AA seqDB search
MLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYGMFFALAANDR
AAFDNLLDWTQNNLAQGSLKENLPAWLWGKKENSKWEVLDSNSASDGDVWMAWSLLEAGR
LWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNPSYLPPTLAQY
FTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLISSYDAIRVYMW
VGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGFSAAMLPFLQN
RDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDWGQECANSH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggctgcctttagtgttcaggcagcctgtacctggcctgcctgggagcag
tttaaaaaggattacatcagtcaggaagggcgcgtcatcgaccccagcgacgcgcgcaaa
atcaccacctccgaagggcaaagttacggcatgttctttgccctggcggctaacgaccgt
gcagctttcgataatcttctcgactggacgcagaacaatctcgctcagggttctttaaaa
gaaaatttgcccgcctggctgtggggcaagaaagagaacagtaagtgggaagtgctggac
agcaattcggcctccgatggtgatgtctggatggcctggtcgttgctggaggcggggcgt
ttgtggaaagagcagcgttataccgacatcggcagcgcattgctaaaacgtatcgcgcgg
gaggaagtggtgacggtgcctgggctgggctccatgttgttaccgggcaaagtgggtttt
gctgaggataacagctggcgttttaaccccagctacctgccgccgacgctggcgcagtat
ttcacccgctttggcgcgccgtggaccacgctgcgcgaaaccaatcaacgtttattgctg
gaaaccgccccgaaaggcttttcgccagactgggtgcgctatgagaaagacaaaggctgg
cagctaaaagccgaaaaaacgttgatcagcagctacgacgctatccgcgtttacatgtgg
gtaggcatgatgcctgacagcgatccgcaaaaagcgcggatgctcaaccggtttaaaccg
atggcgacattcactgagaaaaacggttatccgccggaaaaagtggatgtggctacgggg
aaagcgcagggtaaaggaccggtcggtttttctgccgccatgctgccctttttacaaaac
cgcgatgcgcaggccgttcagcgccagcgcgtggccgataactttcccggcagcgatgcc
tattacaactatgtgctgaccctgtttggacaaggctgggatcaacaccgtttccgcttc
tcgacaaaaggtgagttattacctgactggggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system