KEGG   Escherichia coli NA114: ECNA114_3940Help
Entry
ECNA114_3940      CDS       T01998                                 

Gene name
hemX2
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ena  Escherichia coli NA114
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECNA114_3940 (hemX2)
Enzymes [BR:ena01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ECNA114_3940 (hemX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4067315..4068055)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPTYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKCALILRGNGGRELIGDSLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
TVVVTSGEMLQQLWSLIPQWYREHWLLRCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctggtcacccgcccgtctcccgcaggagaagagttagtgagccgtctgcgc
acactggggcaggtggcctggcattttccgctgattgagttttctccgggtcgacaatta
ccgcaacttgctgatcaactggcagcgctgggagagagcgatctgttgtttgccctctcg
caacacgcggttgcttttgcccaatcacagctgcatcagcaagatcgtaaatggccccga
ctacctacttatttcgccattggacgcaccaccgcgctggcactacataccgtaagcgga
cagaagattctctacccacaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggcaaatgtgcgctgatattacgtggcaatggcggtcgtgagcta
attggggattccctgacggcgcgcggtgctgaggtcactttttgtgaatgttatcaacga
tgcgcaatccattacgatggtgcagaagaagcgatgcgctggcaatcccgcgaggtgacg
acggtcgttgttaccagcggtgaaatgttgcagcaactctggtcgctgatcccacaatgg
tatcgtgagcactggttactacgctgtcgactattggtcgtcagtgagcgtttggcgaaa
ctcgcccgggaactgggctggcaagacattaaggtcgccgataacgctgacaacgatgcg
cttttacgggcattacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system