KEGG   Escherichia coli NA114 (UPEC): ECNA114_4220Help
Entry
ECNA114_4220      CDS       T01998                                 

Definition
(GenBank) Putative succinyl-CoA ligase
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00020  Citrate cycle (TCA cycle)
ena00640  Propanoate metabolism
ena00660  C5-Branched dibasic acid metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01130  Biosynthesis of antibiotics
ena01200  Carbon metabolism
Module
ena_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ena_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECNA114_4220
   00640 Propanoate metabolism
    ECNA114_4220
   00660 C5-Branched dibasic acid metabolism
    ECNA114_4220
Enzymes [BR:ena01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECNA114_4220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AEG39064
Position
4359818..4360987
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKSLLAGMGMPCPKEIAIQQISQLADAWQHIACPSKGAVLKAQVHAGGRGKAG
GVKVLKQLPEAQAFVQQMLGSQLVTYQTGPEGQYVSSILLCENIYPVRQELYFGMVVDRE
SQRVTFIVSPEGGVEIEKVAHETPEKISSVSIDPLTGVQPCHIREMFAVLQLEHGLFAAF
SRLVNQAWKAFNELDFALLEINPLVLRETGEFMCADAKVSLDDNALYRHPELQVLRDETQ
EDPRESQAAKLDLNYVSLDGNIGCMVNGAGLAMATMDIIKLYGEQPANFLDVGGGATQER
VSEAFRLIVSDSKVKAILVNIFGGIVRCDMIARAIIHALNEASITLPVVVRLSGNNAAEG
QRLLAESGLTVEAVDSLDDAAKRIIALLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggccaaatcgttactggctggcatggggatgccgtgtcca
aaagagatagctatccaacagatttcgcaactggcagatgcctggcaacatattgcttgc
ccgagtaaaggcgcggtacttaaagcgcaggtacatgctggtgggcgcggtaaagctggc
ggcgtaaaagtgcttaagcagctgccggaagcacaggcttttgtacagcaaatgttggga
tcgcaactggtgacttatcagaccgggccagaaggacagtatgtcagcagtattttactg
tgcgaaaacatttatccggtacgccaggaactctattttggcatggtggtggatcgtgaa
agccagcgggtcacgtttattgtcagcccggaaggtggtgtggaaattgaaaaagtcgcc
catgagacaccggagaaaatcagcagtgtcagcattgatccactgacaggcgtgcagcct
tgccatatccgcgaaatgtttgctgttctgcaactggaacacggactatttgctgccttt
agtcgcctggttaatcaggcgtggaaagcctttaacgaactggattttgccctgctggaa
attaaccctctggtgttgcgggaaacgggcgaatttatgtgtgcagacgcgaaagtatcg
ctggatgataacgcgctgtatcgtcacccggaactccaggtgctacgtgatgaaacccag
gaagatccacgcgaaagccaggcagcgaagcttgatcttaattatgtctcgctggacgga
aatatcggctgcatggtcaatggtgcagggctggctatggcaaccatggacatcatcaag
ctatacggtgaacaacccgcaaacttcctggatgttggcggtggcgcaacccaggagcgc
gtcagtgaagcctttcggctgattgtttccgacagcaaagtgaaagccattctggttaat
atttttggtgggattgtccgttgcgacatgatcgccagagccattattcatgctctgaat
gaggccagcatcaccctgcctgtcgtggtgcgtctctccggtaataacgccgccgaaggg
cagcggttactggcagaaagtggtctgacggtggaagccgtcgattctctggatgatgcc
gcgaaacgcatcattgcgttactgaattaa

DBGET integrated database retrieval system