KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00113Help
Entry
ECL_00113         CDS       T01231                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECL_00113
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ECL_00113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(114422..115045)
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRKPRPGEVHGEHYFFVDHD
EFKAMIGRDAFLEHAEVFGNYYGTSRETIEQVLATGVNVFLDIDWQGAQQIRKKMPDSRS
IFILPPSKDELDRRLRGRGQDSEEVIAKRMEQAVAEMSHYAEYDYLIVNDDFDAALSDLK
TILRAERLRMSRQKQRHDALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttctgcccctagtggcgcgggtaaatccagcctt
attcaggcactgttaaaaacccaaccgttgtatgacactcaggtttctgtttcacacacc
acgcgtaaaccgcgtccgggtgaagtgcacggtgagcactatttctttgtcgatcacgac
gaatttaaagcgatgattggccgagatgcgtttcttgaacacgcagaagtattcgggaac
tactacggtacttcgcgtgaaaccattgagcaggttctggcaaccggcgtgaatgtgttc
ctggatatcgactggcagggcgcacagcaaattcgcaagaaaatgcctgattcgcgcagt
atctttattttaccgccgtcgaaagatgagctggaccgccgcctgcgtggccgcggtcag
gacagcgaagaggtcattgcaaagcgtatggaacaggcagttgcagaaatgagccattac
gccgaatatgattaccttattgtgaatgatgattttgatgccgcactgagcgatctcaaa
accatccttcgcgcagaacgtctgcgtatgagccgccagaagcagcgacatgacgcatta
atcaccaaactgttggcagactga

DBGET integrated database retrieval system