KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00152Help
Entry
ECL_00152         CDS       T01231                                 

Definition
phosphoglyceromutase
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_00152
   01230 Biosynthesis of amino acids
    ECL_00152
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_00152
  Energy metabolism
   00680 Methane metabolism
    ECL_00152
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECL_00152
Enzymes [BR:enc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ECL_00152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148458..150002)
Genome map
AA seq 514 aa AA seqDB search
MSVSKKPMVLVILDGYGYREDQQDNAIFNAKTPVMDALWAKRPHTLIDASGLEVGLPDRQ
MGNSEVGHVNLGAGRIVYQDLTRLDVEIKERTFFANPVLCGAVDKAVAAGKAVHIMGLLS
AGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAKGSLEAFEEKFAALGKGR
VASIIGRYYAMDRDNRWDRVEQAYDLMTLAKGEFQFATAVEGLEAAYARDENDEFVKATV
IRAEGQADAAMEDGDALIFMNFRADRAREITRAFVNSDFDGFARKKAVNINFIQLTEYAA
DIDAPCAYPPASLANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFKGEDRILI
NSPKVATYDLQPEMSSAELTEKLVAAIVSGKYDTIICNYPNGDMVGHTGVMEAAIKAVEA
LDHCVEQVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYVGDKALKA
VEGGKLSDVAPTMLSLMGMPIPEEMTGKPLFIVE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttctaaaaaacctatggtactggtgattctggatggctatggctaccgtgaa
gatcaacaggataacgccattttcaacgctaaaaccccggtcatggatgcactgtgggca
aaacgtccccacactctgattgacgcatccggcctggaagtgggcctgccggaccgtcag
atgggtaactctgaagtcggtcacgtcaacctgggcgccgggcgcattgtctatcaggat
ctgacgcgtctggatgttgaaatcaaagaacgcaccttcttcgccaaccctgtgctgtgt
ggtgcggtggataaagccgttgccgcaggcaaagccgtgcatatcatgggtctgctgtct
gccggcggcgttcatagccatgaagatcatattatggcgatggttgaactggccgctgag
cgcggtgcggaaaaaatctacctgcacgcgttcctggatggccgcgatacgccaccgcgt
agcgctaaaggttcgctggaagccttcgaagagaaatttgccgcactgggcaaaggccgc
gtggcatctattattggccgctactacgccatggatcgcgataatcgctgggatcgtgtg
gaacaggcctatgacctgatgacgctggcaaaaggcgagttccagtttgcgactgccgtt
gagggccttgaagccgcgtacgcgcgcgatgaaaacgacgaattcgtgaaagcgaccgtc
attcgcgcagaaggccaggctgatgccgccatggaagatggcgacgcgctgatcttcatg
aacttccgtgctgaccgtgcgcgtgaaatcacccgcgcattcgttaacagcgatttcgac
ggtttcgcccgtaagaaagcggtgaacatcaacttcatccagttgaccgaatacgccgct
gacatcgacgccccatgcgcttacccaccagcttcactggccaataccttcggtgagtgg
atggcgaaaaacgataagacgcagttgcgtatctccgaaaccgagaaatatgcccacgtc
accttcttctttaacggcggtgtagaagagccgttcaaaggcgaagatcgcattctgatt
aattcaccaaaagttgctacctatgacctgcagccagagatgagctctgcggaattgacc
gaaaaactggttgcggcgatcgttagcggcaaatacgacaccatcatctgtaactatccg
aacggtgacatggtgggtcataccggggtgatggaagcggctattaaagcggttgaagcg
ctggatcactgcgttgagcaggttgccaaagcggttgaatccgttggcggccagctgctg
attaccgctgaccacggtaacgcagagcagatgcgcgacccggcaaccggacaggcgcat
acggcccacaccaacctgccggttccgctgatttatgtaggtgataaagcactgaaagca
gtggaaggcggcaagctttctgacgtcgcgccaaccatgttgtcgctgatgggtatgccg
atccctgaagagatgactggtaagccgctgttcatcgtggaataa

DBGET integrated database retrieval system