KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00152Help
Entry
ECL_00152         CDS       T01231                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00010  Glycolysis / Gluconeogenesis
enc00260  Glycine, serine and threonine metabolism
enc00680  Methane metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01200  Carbon metabolism
enc01230  Biosynthesis of amino acids
Module
enc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
enc_M00002  Glycolysis, core module involving three-carbon compounds
enc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_00152
  Energy metabolism
   00680 Methane metabolism
    ECL_00152
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECL_00152
Enzymes [BR:enc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ECL_00152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Sulfatase PglZ PPR_long
Motif
Other DBs
NCBI-GeneID: 9122663
NCBI-ProteinID: YP_003610669
UniProt: A0A0H3CEN0
Position
complement(148458..150002)
Genome map
AA seq 514 aa AA seqDB search
MSVSKKPMVLVILDGYGYREDQQDNAIFNAKTPVMDALWAKRPHTLIDASGLEVGLPDRQ
MGNSEVGHVNLGAGRIVYQDLTRLDVEIKERTFFANPVLCGAVDKAVAAGKAVHIMGLLS
AGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAKGSLEAFEEKFAALGKGR
VASIIGRYYAMDRDNRWDRVEQAYDLMTLAKGEFQFATAVEGLEAAYARDENDEFVKATV
IRAEGQADAAMEDGDALIFMNFRADRAREITRAFVNSDFDGFARKKAVNINFIQLTEYAA
DIDAPCAYPPASLANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFKGEDRILI
NSPKVATYDLQPEMSSAELTEKLVAAIVSGKYDTIICNYPNGDMVGHTGVMEAAIKAVEA
LDHCVEQVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYVGDKALKA
VEGGKLSDVAPTMLSLMGMPIPEEMTGKPLFIVE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttctaaaaaacctatggtactggtgattctggatggctatggctaccgtgaa
gatcaacaggataacgccattttcaacgctaaaaccccggtcatggatgcactgtgggca
aaacgtccccacactctgattgacgcatccggcctggaagtgggcctgccggaccgtcag
atgggtaactctgaagtcggtcacgtcaacctgggcgccgggcgcattgtctatcaggat
ctgacgcgtctggatgttgaaatcaaagaacgcaccttcttcgccaaccctgtgctgtgt
ggtgcggtggataaagccgttgccgcaggcaaagccgtgcatatcatgggtctgctgtct
gccggcggcgttcatagccatgaagatcatattatggcgatggttgaactggccgctgag
cgcggtgcggaaaaaatctacctgcacgcgttcctggatggccgcgatacgccaccgcgt
agcgctaaaggttcgctggaagccttcgaagagaaatttgccgcactgggcaaaggccgc
gtggcatctattattggccgctactacgccatggatcgcgataatcgctgggatcgtgtg
gaacaggcctatgacctgatgacgctggcaaaaggcgagttccagtttgcgactgccgtt
gagggccttgaagccgcgtacgcgcgcgatgaaaacgacgaattcgtgaaagcgaccgtc
attcgcgcagaaggccaggctgatgccgccatggaagatggcgacgcgctgatcttcatg
aacttccgtgctgaccgtgcgcgtgaaatcacccgcgcattcgttaacagcgatttcgac
ggtttcgcccgtaagaaagcggtgaacatcaacttcatccagttgaccgaatacgccgct
gacatcgacgccccatgcgcttacccaccagcttcactggccaataccttcggtgagtgg
atggcgaaaaacgataagacgcagttgcgtatctccgaaaccgagaaatatgcccacgtc
accttcttctttaacggcggtgtagaagagccgttcaaaggcgaagatcgcattctgatt
aattcaccaaaagttgctacctatgacctgcagccagagatgagctctgcggaattgacc
gaaaaactggttgcggcgatcgttagcggcaaatacgacaccatcatctgtaactatccg
aacggtgacatggtgggtcataccggggtgatggaagcggctattaaagcggttgaagcg
ctggatcactgcgttgagcaggttgccaaagcggttgaatccgttggcggccagctgctg
attaccgctgaccacggtaacgcagagcagatgcgcgacccggcaaccggacaggcgcat
acggcccacaccaacctgccggttccgctgatttatgtaggtgataaagcactgaaagca
gtggaaggcggcaagctttctgacgtcgcgccaaccatgttgtcgctgatgggtatgccg
atccctgaagagatgactggtaagccgctgttcatcgtggaataa

DBGET integrated database retrieval system