KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00266Help
Entry
ECL_00266         CDS       T01231                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_00266
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECL_00266
   00630 Glyoxylate and dicarboxylate metabolism
    ECL_00266
Enzymes [BR:enc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECL_00266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271637..273238
Genome map
AA seq 533 aa AA seqDB search
MTQQATTVDELAFTQPYGEQEQQILTAEAVEFLTELVTRFTPQRNKLLAARIHQQQEIDN
GKLPGFISETASIRRGDWKIRGIPEDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMHEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKELEARNG
HDGTWIAHPGLADTAMEVFNHVLGDNKNQLFVTRDDDAPIAEEQLLAPCSGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKSLFR
QMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaacgacggtcgatgaactggcctttacccagccgtatggcgagcaa
gaacagcaaattttgacggctgaggcggttgaattcctgactgaactggtgacccgcttt
acgccgcagcgcaataagctgctggctgcacgcattcatcaacagcaggaaattgataat
ggcaagctgcctgggtttatttcggaaaccgcttccattcgacgcggcgactggaaaatc
cgcggcatccctgaagatttgcaggatcgccgcgttgagatcactggtccggtagagcgc
aaaatggtgatcaacgccatgaacgccaacgttaaagtctttatggcggattttgaggac
tccctggccccggactggcgtaaagtgatcgacgggcagatcaacctgcgcgatgccgtt
aatggcaccatcagctataccaacgaagccggtaaaatttatcagctgaaacccaatccg
gcggttctgatctgccgcgtacgcggcctgcacctgccggaaaaacacgtcacgtggcgc
ggagaagcgattccgggcagcctgtttgattttgccctctatttcttccacaaccacaaa
aacctgctggcaaaaggcagtggcccctatttctacctgccgaagacccaggcctggcag
gaagcggcctggtggagtgaggtgttcagctacgcggaagatcgcttcaacctgccgcgt
ggcaccattaaagccaccctgctgattgaaacgctgcctgccgtattccagatgcatgaa
atcctgcacgctctgcgcgatcacattgtgggtctgaactgcggacgctgggactacatc
ttcagctatatcaaaacgttgaaaaaccaccccgatcgcgtactgccggatcgccaggtt
gtcaccatggataaaccgttcctcagcgcctactcgcgcctgctgattaaaacctgccac
aagcgcggtgcctttgcgatgggcggcatggcggcctttattccgagcaaagacgctgag
cgtaacaatcaggtgctcaacaaggtgaaagctgacaaggagcttgaagcgcgtaacggt
cacgacggcacgtggatcgcccatccgggcctggccgatacggcaatggaagtctttaac
cacgtactcggtgacaacaaaaaccagctgtttgtcacccgtgatgacgatgccccaatc
gcagaagagcaacttctggcgccgtgctcgggtgaacgcacggaagagggcatgcgtgcc
aatatccgcgtggccgtgcagtacatcgaagcgtggatctccggtaacggctgtgtgccc
atctacggtcttatggaagacgcggcgacggcagaaatctcccgtacctctatctggcag
tggatccaccatcagaaaacgctcagcaacggcaagccggtgaccaaatccctgttccgc
cagatgctggccgaagagatgcgcgtcattcaggacgagctgggcgaacaccgcttcagc
agcggacgttttgatgatgccgcccgcctgatggagcaaatcacaacctcagatgactta
atcgacttcctcaccctgccaggctaccgcctgcttgcgtaa

DBGET integrated database retrieval system