KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00267Help
Entry
ECL_00267         CDS       T01231                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_00267
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECL_00267
Enzymes [BR:enc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ECL_00267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
273271..274575
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQNGAVKMWHLLHGG
SKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAADL
ITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAKR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDNVTTIIQGGAS
SVTALTGSTEEAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaactgaagaaagagtggacacagccgcgctgg
gaaggtatccgtcgcccatacagcgctgaggaagtggtgaaactgcgtggctcggtcaat
ccggaatgcacgctggcgcaaaatggcgcggtgaagatgtggcatctgctgcatggcggc
tccaaaaagggctacatcaacagcctcggtgcactgaccggcggtcaggcgttgcagcag
gcgaaggccggtatcgaagccatttatctttccggctggcaggtcgcggcggatgccaac
ctggcctccagcatgtatccggatcagtcgctctatccggcaaactcggtgccgtcggtg
gtggatcggatcaacaacaccttccgccgtgcggatcagatccagtgggcggcaggtatt
gagccaaacgatccgcgctttattgactacttcctgccgatcgtcgcggatgcagaagcc
ggtttcggcggcgtgctgaacgcctttgagctgatgaaatcgatgattgaggccggtgca
gcggccgtacacttcgaagatcagctggcctcggtgaagaaatgcggacacatgggcggc
aaagtgctggtcccgacccaggaagcgattcagaagctggtcgctgcgcgtctggccgct
gacgtgctcggcgtgccgacgctggtgattgcccgtaccgacgcggacgcggctgacctg
atcacctctgactgcgatccatacgacagcgagttcattaccggcgagcgcaccagcgaa
ggattctatcgtacccatgctggcattgagcaggccatcagccgtggcctggcgtatgca
ccgtacgcagacctggtctggtgcgaaacctccacgccggacctggcgctggcaaaacgc
tttgccgatgctatccacgccaaatacccgggcaaactgctggcctataattgctcgccg
tccttcaactggcagaagaatctggacgataaaaccatcgccagcttccagcagcagctg
tcagacatgggctacaagtatcagttcatcaccctggcggggatccacagcatgtggttc
aacatgttcgacctggcgcacgcctacgcgcagggtgaaggcatgaagcactatgtcgag
aaagtgcagcagccggagtttgccgcgggcaaagagggctatacctttgtttctcatcag
caggaggtgggaaccggttactttgataatgtgaccacgattattcagggcggcgcctcc
tccgtcactgccttaacggggtcaacagaagaagcacagttctaa

DBGET integrated database retrieval system