KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00501Help
Entry
ECL_00501         CDS       T01231                                 

Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_00501
   01230 Biosynthesis of amino acids
    ECL_00501
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_00501
  Energy metabolism
   00680 Methane metabolism
    ECL_00501
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECL_00501
Enzymes [BR:enc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECL_00501
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECL_00501
  Exosomal proteins of melanoma cells
   ECL_00501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(501699..502022)
Genome map
AA seq 107 aa AA seqDB search
METLNLLWLPVSKTWRLNERHYGALQGMRKDEAAQQMGEELVYHWRKSYRGIPPLLAAAP
QLLHREARYHHIALSDLPKGESLEMALRRVIPYWQHVIAPRVVSGLC
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggagacactgaacctgttatggctgccagtgagtaaaacctggcggttgaatgaacgt
cattatggcgccctgcaagggatgaggaaagatgaagcggcacaacaaatgggcgaggaa
ctggtgtatcactggcgaaaaagttaccgaggtattccgcctttgcttgcggcagcccca
caacttctccatcgcgaagcccgctatcaccatattgctctgtcagatctcccaaaaggt
gaaagtcttgagatggcactacgaagagttataccttactggcagcatgtcatcgctccc
cgcgtcgtcagcgggctttgttga

DBGET integrated database retrieval system