KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00783Help
Entry
ECL_00783         CDS       T01231                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECL_00783
   00240 Pyrimidine metabolism
    ECL_00783
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECL_00783
   03430 Mismatch repair
    ECL_00783
   03440 Homologous recombination
    ECL_00783
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECL_00783
DNA replication proteins [BR:enc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECL_00783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
774133..774546
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPTALQGEIAIAIPAHVRLVMVAEELPALNDALIGDVLRS
LKLTADQVLQLTPDRVAMLPPDSHCNCWRMGETNDISLSGSQISSPVLEELKANPKARSA
LWQQICEYEHDFFPHDA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgtgactggcagttgcagcagctgggtatcacccagtgggccttgcgt
cgcccgacggcgttgcagggtgaaatcgccatcgccatccctgcgcatgtgcgtctggtg
atggtggcggaagaactgcctgccctgaatgatgccctgattggtgatgtccttcgcagc
ctgaagctgacggccgaccaggttttacagctgacgccggacagggtcgccatgcttcct
cctgacagccattgcaactgctggcgaatgggcgagacaaacgacatatccctttccggg
agccagatcagctcccccgtgctggaagagctgaaagccaacccaaaagcgcgaagcgcg
ctatggcaacaaatctgcgaatatgaacacgatttcttccctcacgacgcctga

DBGET integrated database retrieval system