KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00794Help
Entry
ECL_00794         CDS       T01231                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECL_00794
Enzymes [BR:enc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ECL_00794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
784016..785338
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAQLAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
QAVLDNGKAAEIFGRMVAAQKGPTDFVENYAKYLPTATLSKAVYADSEGFVSAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSVDGERPLAVIHAKDEASWQEAAKAVKAA
ITLADKAPESSPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcattaagcgacgaa
gagatccgcttctttatcaacggcattcgagataacaccatctcagaagggcagattgca
gccctggcgatgaccatcttcttccacgatatgtcgatgcctgagcgtgtctcgttgacc
atggcgatgcgagattcaggaaccgtactggactggaagagcctcaacctcaacggcccg
attgtcgacaaacactccaccggcggcgtaggcgatgtaacgtctctgatgctcggcccc
atggtggcggcctgcggcggttatatcccgatgatctccgggcgcggcctgggacacacc
ggcggtacgctcgacaaactggaagccattccgggcttcgatatcttcccggatgacaac
cgcttccgcgaaattattaaagacgttggcgtggcgatcatcggccagaccagctcgctc
gccccggcagacaagcgcttctacgcaacccgcgatatcaccgcaaccgttgactccatc
ccgctgatcaccgcctctattctggcgaagaaactggcagaggggctggacgcgctggta
atggacgtaaaagtgggtagcggcgcgtttatgccaacctatgaactctctgctcagctt
gctgaagcgattgttggcgttgccaacggcgcaggcgtgcgcaccaccgcactgctgacg
gacatgaatcaggtgctggcctccagcgctggtaacgccgtcgaagtgcgcgaagccgtt
cagtttctgacaggcgaataccgcaacccacgactgttcgacgtgaccatggcgctgtgc
gtcgagatgctgatttcaggcaaactggcgaaagacgacgctgaagcgcgcgcgaagctg
caggcggtgctggataacggcaaagcggcagaaatctttggccgcatggtggcggcgcaa
aaaggcccgaccgatttcgtggaaaactacgcgaaatacctgccgaccgcgacgctcagc
aaagccgtttatgccgatagcgaaggtttcgtctctgctatggacacccgtgcactgggt
atggcggtggtctcgatgggcggcggccgtcgtcaggcatcggacactattgattacagc
gttggctttaccgatatggcccgtctgggcgacagcgttgacggagaacgtccgctggcg
gtgatccacgccaaagacgaagccagctggcaggaggcggcgaaggcggtgaaagcggcc
attacgcttgctgataaagcaccagaaagctcgccttcggtctatcgtcgtatcaccgaa
tag

DBGET integrated database retrieval system