KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00816Help
Entry
ECL_00816         CDS       T01231                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECL_00816
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECL_00816
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECL_00816
Enzymes [BR:enc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ECL_00816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808052..809338
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFQLTDIDELLKQDFVTRSTKILS
AFIGDEIPQELLEERVRAAFAFPAPVQQVEPDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPKGKISPLQEKLFCTLGGNIETV
AVDGDFDACQALVKQAFDDEELKAALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLKDGKWAPNATQATLSNA
MDVSQPNNWPRVEELFRRKVWRLGDLGYAAVTDETTKSTMRELKAVGYTSEPHAAIAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEEILGETLPLPKELADRADLPLLSHELPADFAAL
RKLMMTRA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcataacgagcaggtcagcttcgcgcaggcggtgact
cagggactgggcaaaaatcaggggctgttcttccctcacgatctccctgaattccagctg
accgacattgatgagctgctgaagcaggactttgtcactcgcagcacaaaaattttgtct
gcgtttatcggcgacgaaatcccgcaggagttgctggaagagcgcgtacgtgcggcgttc
gccttcccggcaccggttcagcaggttgagccggatgtgggctgtctggagctgttccac
ggcccaacgctggcgtttaaagacttcggcggccgctttatggcgcagatgcttacccac
atcagcggcgacaagccggtcaccattctgaccgccacctccggggataccggtgccgcc
gtggcgcatgctttttacggtctgaagaacgtccgcgtggtgatcctctatccgaaaggc
aagatcagcccgctccaggaaaaactgttctgcaccctcggcggtaacattgaaaccgtg
gcggtagatggcgacttcgatgcctgtcaggcgctggtgaaacaggccttcgacgatgaa
gagctgaaagccgcgctggggctcaactctgctaactccattaacatcagccgtctgctg
gcgcagatttgctactacttcgaagcggttgcccaactgccgcaagaggcgcgcaatcag
ctggtggtttcggtaccgagcggaaactttggcgacctgaccgcgggcctgctggcgaaa
tccctcgggctgccggtgaaacgctttattgcggcgaccaacgccaacgacaccgtgcca
cgcttcctgaaagacggtaaatgggcgccgaacgcgactcaggcgacgctctctaacgcg
atggacgtgtcacagccaaacaactggccgcgcgtggaagagctgttccgccgtaaagtg
tggcgtctgggcgatctgggctatgcggcggtcaccgatgaaaccaccaaaagcactatg
cgtgagctgaaagcggtggggtatacctctgaaccgcatgcggcgattgcttaccgtgcg
ctgcgcgaccagctgaatcctggcgagtatggcctgttcctggggacggcgcatccggca
aaattcaaagagagcgtggaagagattctgggtgaaacgctgccgctgccgaaagagctg
gcggatcgcgctgacctgccgctgctctctcatgagctgccagcggattttgccgcgctg
cgtaagctgatgatgacccgagcgtga

DBGET integrated database retrieval system