KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00846Help
Entry
ECL_00846         CDS       T01231                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECL_00846
   00670 One carbon pool by folate
    ECL_00846
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ECL_00846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840372..840851
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRTTLNKPVVMGRLTWESIGRPLPGRKNI
VISSQPGTDDRVEWVKSVDEAIAACGNAEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcagcgctggcggtggaccgtgttatcggtatggaaaatgccatg
ccgtggaacctgcctgccgatctcgcatggtttaaacgtacgacgttaaacaagccggta
gtgatgggccgcctgacctgggagtcgattggtcgtccattgccgggccgtaagaatatc
gtgatcagtagccagccaggcactgacgatcgcgtcgaatgggtgaaatccgtggacgag
gcgattgccgcctgcggtaacgccgaagagatcatggtgattggtggtgggcgtgtatat
gagcagttcctgccaaaagcgcaaaagctctatctgacgcatattgatgcggaagtggaa
ggcgatacccatttcccggactacgatccggacgagtgggaatcggtattcagcgaattt
cacgacgcggatgcgcagaactcacacagctactgcttcgagattctggaacgtcgctag

DBGET integrated database retrieval system