KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00882Help
Entry
ECL_00882         CDS       T01231                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ECL_00882
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECL_00882
Enzymes [BR:enc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ECL_00882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882360..883847
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPNAPERALREMVLDSRVAASGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYNEPSDQLRLVGVTGTNGK
TTTTQLMAQWAQLLGETGAVMGTVGNGLLGKVSPTENTTGSAVDVQHVIAGLAGQGATFA
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLFSTHHYGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKAVEVNYHDSGATIRFASSWGEGEIE
SRLMGAFNVSNLLLALATLLALGYPMAELLNTAERLQPVCGRMEVFSAPGKPTVVVDYAH
TPDALEKALEAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEQFADIPVVTDDNPRTEE
PRAIINDILAGMLDAGRARVVEGRAEAVTNAIMQAQENDVVLLAGKGHEDYQIVGNRRLD
YSDRVTAARLLGVVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttctcgctccgtgggtgccaaacgcacctgagcga
gcgctacgggagatggtactggacagccgtgtggctgcttccggcgatctttttgtggct
gtagttggtcatcaggcggacgggcgtcgatatatcccgcaggcgattgcgcaaggtgta
gctgccattattgctgaggctaaagatgaggcaaccgacggtgaaatccgtgaaatgcac
ggtgtgccggttatctaccttagccagttgaatgagcgactctccgcactggcgggacgt
ttttataacgagccttcagaccagctgcgtctggtgggcgtgacgggcactaacggtaaa
acgacgaccacccaattgatggcgcaatgggcgcaactgctgggagaaaccggcgccgta
atgggcaccgtggggaatgggctgctgggtaaagtgagcccgacggaaaacaccaccggc
tccgcggttgacgtacaacatgtgattgccggtctggcagggcagggtgcgacctttgcc
gcgatggaagtctcctctcatggtctggtacagcatcgtgtggcggcgttgaaatttgcc
gcctccgtgttcacgaacctgagtcgcgatcatcttgattatcatggtgatatggagcat
tacgaggccgcgaaatggctgctcttctccacgcatcactatggacaggccatcatcaac
gctgatgacgaagtggggcgccgctggcttgcgaagctgccggatgcggttgcggtgtcg
atggaagaccatatcaatccgaactgccatggccgctggctgaaggcggttgaggttaat
tatcacgacagcggcgcgacgattcgctttgcctcttcctggggtgaaggcgaaattgaa
agccgcctgatgggggcgtttaacgtcagcaacctcctgctggcgctggcaaccctgctg
gcgttgggctatccgatggccgaactgctcaacaccgcagagcgtctgcagcccgtctgt
ggccgtatggaagtgttcagtgcaccaggtaaaccgaccgttgttgtcgattatgcccac
acgccggatgcgctggaaaaagcgcttgaagcggcacgtctgcactgcgccggtaagctc
tggtgtgtgtttggctgtgggggcgatcgtgacaagggcaagcgtccgttgatgggtgcc
atcgccgaacagttcgcggatattccggttgtgaccgatgacaacccgcgtactgaagag
ccgcgcgccattatcaacgatatcctggccggtatgctggacgcaggacgtgcccgcgtg
gtggaaggccgtgcggaagccgtgaccaacgccatcatgcaggcgcaggagaacgacgtc
gtgctcctggcgggtaaaggccatgaagattatcagattgttggcaatcgtcgtctggac
tattcggaccgtgtaacggcagcgcgtctgttgggagtggtggcatga

DBGET integrated database retrieval system