KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00921Help
Entry
ECL_00921         CDS       T01231                                 

Definition
(RefSeq) Phage-related lysozyme (muraminidase)
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
Enzymes [BR:enc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECL_00921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme DUF932
Motif
Other DBs
NCBI-GeneID: 9123427
NCBI-ProteinID: YP_003611433
UniProt: A0A0H3CFR5
Position
complement(927700..928149)
Genome map
AA seq 149 aa AA seqDB search
MSNALKTTGNGGIALIKQYEGLRLTTYKDAVGIPTIGYGHVENPIPPGGTRTITAEAAEQ
LLRDDLQRFEHEVNNMLTVEVTQNQFDALVSFAFNLGPANLKSSTLLRKVNSGDVNGAAD
EFLKWNHAGGQVLAGLTARRNAEKTLFLS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgccttgaaaacaaccggcaatggcggcattgcccttatcaaacagtacgaa
ggcctgcgtttaaccacctacaaagacgcagtcggtattccgactatcggttatggtcac
gtcgaaaacccgatcccgccaggcggcacgcggaccatcaccgcagaagccgcagaacag
ctccttcgtgatgacctgcagcgttttgagcacgaggttaacaacatgctgactgtggag
gtgacgcagaaccagttcgatgctctggtgagcttcgccttcaatctgggcccggccaat
ctgaagagttcaaccctgttacgcaaagtgaacagcggagacgttaacggcgccgccgac
gaatttctgaaatggaaccatgcgggtggtcaggtcctggcgggcctgacagcacgtcgt
aacgctgaaaaaactctttttttatcctga

DBGET integrated database retrieval system