KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00921Help
Entry
ECL_00921         CDS       T01231                                 

Definition
Phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(927700..928149)
Genome map
AA seq 149 aa AA seqDB search
MSNALKTTGNGGIALIKQYEGLRLTTYKDAVGIPTIGYGHVENPIPPGGTRTITAEAAEQ
LLRDDLQRFEHEVNNMLTVEVTQNQFDALVSFAFNLGPANLKSSTLLRKVNSGDVNGAAD
EFLKWNHAGGQVLAGLTARRNAEKTLFLS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgccttgaaaacaaccggcaatggcggcattgcccttatcaaacagtacgaa
ggcctgcgtttaaccacctacaaagacgcagtcggtattccgactatcggttatggtcac
gtcgaaaacccgatcccgccaggcggcacgcggaccatcaccgcagaagccgcagaacag
ctccttcgtgatgacctgcagcgttttgagcacgaggttaacaacatgctgactgtggag
gtgacgcagaaccagttcgatgctctggtgagcttcgccttcaatctgggcccggccaat
ctgaagagttcaaccctgttacgcaaagtgaacagcggagacgttaacggcgccgccgac
gaatttctgaaatggaaccatgcgggtggtcaggtcctggcgggcctgacagcacgtcgt
aacgctgaaaaaactctttttttatcctga

DBGET integrated database retrieval system