KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00975Help
Entry
ECL_00975         CDS       T01231                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:enc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986542..987741
Genome map
AA seq 399 aa AA seqDB search
MKHLTLLGSTGSIGCSTLDVVRHNPALYTVTALVAGKNVQRMVEQCLEFTPRYAVMDDEE
SARQLKAALQEKGSRTEVLSGQQAACEMAALDEVDQVMAAIVGAAGLLPTLAAIDAGKDV
LLANKESLVTCGRLFMEAVKQRGARLLPVDSEHNAIFQSLPQPFQQNLGYADLEQNGVVS
ILLTGSGGPFRETPLSELSAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAKQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHAMSWPERVKSGVKPLDFC
KLSSLTFSEPDYDRYPCLKLAMNAFDQGQAATTALNAANEITVEAFLNQQIRFTDIAMLN
LSVLELMDLREPQSVEEVLAVDEQARIIARKQVTRLASW
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatttaactctccttggctcaaccggatctatcggttgcagcactctcgacgtt
gtacgccacaaccctgcgctttacaccgtgacagcactggtggccgggaagaatgtgcag
cgaatggtcgagcagtgtctggagtttacgccccgctatgcggtaatggatgacgaagag
agcgcccgccagctgaaagccgctctgcaagagaagggcagtcgtactgaggttctgagc
gggcagcaggctgcctgtgagatggccgcgctggatgaggtcgatcaggtgatggccgcc
attgttggcgcggccgggttgctgccgacgctggccgccatcgatgccggtaaagatgtt
ctgctggcgaataaagagtcgctggtgacctgcggacgcctgtttatggaggcggttaag
cagcgcggagcacgacttttgccggtcgacagcgagcacaacgccatttttcagagttta
ccgcaaccttttcagcagaacctggggtacgctgacctggagcagaatggggttgtatcg
attttgcttaccgggtctggtggcccgttccgtgaaacgccactgtctgaactgagcgca
atgacgccggatcaggcgtgccgtcatccgaactggtcaatggggcgtaagatctccgtt
gactctgccactatgatgaacaaaggtctggaatacattgaagctcgctggctgtttaac
gcgtcggcgaaacagatggaagtgctgatccacccgcaatcggtgattcactcgatggtg
cgctatcaggacggcagcgtgctggcacagctgggagagccggatatgcgtacgccaatt
gcacatgcaatgtcatggcctgaacgcgtgaaatctggcgtgaagccactcgatttttgc
aagctgagctccctgacgttcagtgaacctgactacgatcgttatccgtgtcttaagctt
gcaatgaatgcctttgaccaggggcaggcggcgacgacggcactcaatgcagccaatgaa
attaccgttgaagcatttctgaatcagcagatccgtttcaccgatatcgctatgctgaat
ttgtcggtactggagttgatggatctgcgcgaacctcaaagcgtggaagaggtgctggcg
gtagatgagcaggctcgtattattgcgcgcaaacaggtgacacgtctcgcaagctggtga

DBGET integrated database retrieval system