KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01074Help
Entry
ECL_01074         CDS       T01231                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECL_01074
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECL_01074
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ECL_01074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105321..1106424
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPEAELITDVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGSRPG
VIGDVMEGISVGTRFHAQESPLENRKRWIFGAPPAGELTVDEGATAAILERGSSLLPKGI
KNVTGNFSRGEVIRIRNLEGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgttttaacaggcggatcg
cgccgcctaaatcgcgcccacattgttgagcttgtacgtcagtgcgctcagctgcatgcc
gcagggcatcgtattgttattgtgacctccggggcgattgccgccgggcgtgaacatctg
ggttaccccgaactccccgcgacgatcgcctctaaacagctgctggccgccgtgggacaa
agccgactcattcaactctgggaacagttgttctcaatctatggcattcacgtcgggcag
atgctgctgacgcgcgcggatatggaagacagagaacgcttcctgaacgcccgcgatacg
ctgcgcgcgctgctggacaacaatatcgtcccggtgattaacgaaaacgacgccgtggct
accgctgaaatcaaagtgggtgacaacgataacctctctgcgctggcggcgatcctggcc
ggtgccgacaagctcttgctcctgacggaccagcaggggctgtttaccgcagacccgcgc
tccaacccggaagctgaactgattaccgatgtgcacggcattgacgatgcgctgcgcgcc
atcgccggcgacagcgtctctggcctgggaacgggcggcatgggcactaaactgcaggcg
gcggatgtggcctgccgcgccgggatcgacaccatcattgcggcgggcagccgtcctggc
gtcattggcgacgtgatggaaggcatttccgttggcacgcgcttccacgcccaggaatcc
ccgctggaaaaccgcaaacgctggattttcggcgcgccgccggcaggtgaactgaccgtg
gatgaaggggcgaccgccgcgattctggaaagagggagttcattgcttcctaaaggaatt
aaaaacgtgacaggcaacttctcccgtggtgaagtgatccgtatccgtaaccttgaaggt
cgcgacatcgctcacggcgtcagccgctacaacagcgatgctctgcgccgtattgcgggt
caccactcgcagcagatcgacgccattctgggctacgagtatggcccggttgccgtgcat
cgtgacgacatgattattcgttaa

DBGET integrated database retrieval system