KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01074Help
Entry
ECL_01074         CDS       T01231                                 

Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00330  Arginine and proline metabolism
enc00332  Carbapenem biosynthesis
enc01100  Metabolic pathways
enc01130  Biosynthesis of antibiotics
enc01230  Biosynthesis of amino acids
Module
enc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECL_01074
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ECL_01074
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ECL_01074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 9123578
NCBI-ProteinID: YP_003611584
UniProt: A0A0H3CG68
Position
1105321..1106424
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPEAELITDVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGSRPG
VIGDVMEGISVGTRFHAQESPLENRKRWIFGAPPAGELTVDEGATAAILERGSSLLPKGI
KNVTGNFSRGEVIRIRNLEGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgttttaacaggcggatcg
cgccgcctaaatcgcgcccacattgttgagcttgtacgtcagtgcgctcagctgcatgcc
gcagggcatcgtattgttattgtgacctccggggcgattgccgccgggcgtgaacatctg
ggttaccccgaactccccgcgacgatcgcctctaaacagctgctggccgccgtgggacaa
agccgactcattcaactctgggaacagttgttctcaatctatggcattcacgtcgggcag
atgctgctgacgcgcgcggatatggaagacagagaacgcttcctgaacgcccgcgatacg
ctgcgcgcgctgctggacaacaatatcgtcccggtgattaacgaaaacgacgccgtggct
accgctgaaatcaaagtgggtgacaacgataacctctctgcgctggcggcgatcctggcc
ggtgccgacaagctcttgctcctgacggaccagcaggggctgtttaccgcagacccgcgc
tccaacccggaagctgaactgattaccgatgtgcacggcattgacgatgcgctgcgcgcc
atcgccggcgacagcgtctctggcctgggaacgggcggcatgggcactaaactgcaggcg
gcggatgtggcctgccgcgccgggatcgacaccatcattgcggcgggcagccgtcctggc
gtcattggcgacgtgatggaaggcatttccgttggcacgcgcttccacgcccaggaatcc
ccgctggaaaaccgcaaacgctggattttcggcgcgccgccggcaggtgaactgaccgtg
gatgaaggggcgaccgccgcgattctggaaagagggagttcattgcttcctaaaggaatt
aaaaacgtgacaggcaacttctcccgtggtgaagtgatccgtatccgtaaccttgaaggt
cgcgacatcgctcacggcgtcagccgctacaacagcgatgctctgcgccgtattgcgggt
caccactcgcagcagatcgacgccattctgggctacgagtatggcccggttgccgtgcat
cgtgacgacatgattattcgttaa

DBGET integrated database retrieval system