KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01128Help
Entry
ECL_01128         CDS       T01231                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00860  Porphyrin and chlorophyll metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
Module
enc_M00121  Heme biosynthesis, glutamate => heme
enc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECL_01128
Enzymes [BR:enc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ECL_01128
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECL_01128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 9123632
NCBI-ProteinID: YP_003611638
UniProt: A0A0H3CFN4
Position
complement(1162520..1163494)
Genome map
AA seq 324 aa AA seqDB search
MTDLIARPRRLRKSPALRAMFEETTLTLNDLVLPIFVEEEIDDYKAIDAMPGVMRIPEKY
LAREIERIANAGIRSVMTFGISHHTDATGSDAWKEDGLVARMSRICKETVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLLNLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPLNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTELPLGAYQVSGEYAMIKFAAQAGAIDEEKVILESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttaattgctcgtccccgtcgtctgcgcaagtcacctgcactgcgcgctatg
tttgaagagacaacactgaccttaaacgatctggtgttgccgatttttgttgaagaagag
atcgatgactacaaagccatcgacgccatgccaggcgtgatgcgcattccggaaaaatat
ctggcgcgtgagatcgaacgtatcgccaacgcggggatccgctcggtgatgacctttggc
atctcccaccacactgacgctaccggcagcgatgcctggaaagaggacggtctggtcgcc
cggatgtcgcggatctgcaaagagaccgtgccggaaatgatcgtcatgtcagacacctgt
ttctgtgaatatacctctcatggccactgcggtgtgctgtgcgatcacggtgtcgataac
gacgccactttgctgaatctcggcaagcaggcggtggtagctgcagcagccggtgcggat
ttcatcgcaccttccgctgccatggacgggcaggttcaggcgatccgccaggcgcttgat
gcggccggattcaccgataccgccatcatgtcctactccaccaagtttgcctcttcgttc
tacggtccgttccgtgaagcggccggtactgcgctgaagggcgatcgcaaaacctatcag
atgaacccgctgaaccgccgtgaagccatccgtgaatcgctgctggatgaagcccagggc
gcagattgcctgatggtgaaaccagctggcgcatatctggatattctgcgcgacattcgc
gagcgcaccgagctgccgctgggtgcataccaggtgagcggcgagtacgcgatgatcaaa
ttcgccgcgcaggcgggtgccatcgacgaagagaaagtgatcctggaaagcctgggcgcg
atcaaacgtgctggcgcggatctgatcttcagctactttgcgctggatctggccgagaag
aaaattctgcgttaa

DBGET integrated database retrieval system