KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01128Help
Entry
ECL_01128         CDS       T01231                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECL_01128
Enzymes [BR:enc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ECL_01128
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECL_01128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1162520..1163494)
Genome map
AA seq 324 aa AA seqDB search
MTDLIARPRRLRKSPALRAMFEETTLTLNDLVLPIFVEEEIDDYKAIDAMPGVMRIPEKY
LAREIERIANAGIRSVMTFGISHHTDATGSDAWKEDGLVARMSRICKETVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLLNLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPLNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTELPLGAYQVSGEYAMIKFAAQAGAIDEEKVILESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttaattgctcgtccccgtcgtctgcgcaagtcacctgcactgcgcgctatg
tttgaagagacaacactgaccttaaacgatctggtgttgccgatttttgttgaagaagag
atcgatgactacaaagccatcgacgccatgccaggcgtgatgcgcattccggaaaaatat
ctggcgcgtgagatcgaacgtatcgccaacgcggggatccgctcggtgatgacctttggc
atctcccaccacactgacgctaccggcagcgatgcctggaaagaggacggtctggtcgcc
cggatgtcgcggatctgcaaagagaccgtgccggaaatgatcgtcatgtcagacacctgt
ttctgtgaatatacctctcatggccactgcggtgtgctgtgcgatcacggtgtcgataac
gacgccactttgctgaatctcggcaagcaggcggtggtagctgcagcagccggtgcggat
ttcatcgcaccttccgctgccatggacgggcaggttcaggcgatccgccaggcgcttgat
gcggccggattcaccgataccgccatcatgtcctactccaccaagtttgcctcttcgttc
tacggtccgttccgtgaagcggccggtactgcgctgaagggcgatcgcaaaacctatcag
atgaacccgctgaaccgccgtgaagccatccgtgaatcgctgctggatgaagcccagggc
gcagattgcctgatggtgaaaccagctggcgcatatctggatattctgcgcgacattcgc
gagcgcaccgagctgccgctgggtgcataccaggtgagcggcgagtacgcgatgatcaaa
ttcgccgcgcaggcgggtgccatcgacgaagagaaagtgatcctggaaagcctgggcgcg
atcaaacgtgctggcgcggatctgatcttcagctactttgcgctggatctggccgagaag
aaaattctgcgttaa

DBGET integrated database retrieval system