KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01221Help
Entry
ECL_01221         CDS       T01231                                 

Definition
beta galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECL_01221
  Lipid metabolism
   00600 Sphingolipid metabolism
    ECL_01221
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ECL_01221
Enzymes [BR:enc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ECL_01221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1254944..1258036
Genome map
AA seq 1030 aa AA seqDB search
MSNTVSLTLSALLARRDWENPGVTQWNRLAAHAPFHSWRNEHAAREDAASISRRSLNGEW
RFSFFSAPEQVPQAWTGEDCPDAVAMPVPSNWQMQGVDTPVYTNVTYPIPVNPPFVPAEN
PIGCYSLTFEVEDAWLEGGQTRIIFDGVNSAFHLWCNGQWVGYSQDSRLPAEFDLSGVLR
AGQNRLAVMVLRWCDGSYLEDQDMWRMSGIFRDVSLLHKPETYIADYQVVTDLNAELDRS
VLKVDVSLAGAHFAECEVAITLWRNGERCASATRRPGSAIVDERGNWAERLTVAIPVASP
ALWSAETPALYRLTIALLDPQGEVLEIEACDVGFRRVEISNGLLKLNGKPLLIRGVNRHE
HHPENGQVMDEATMRRDIEIMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVDEANIETH
GMVPMSRLADDPRWLPAMSERVTRMVQRDRNHPSIIIWSLGNESGHGANHDALYRWLKTA
DPTRPVQYEGGGANTAATDIICPMYARVDQDQPFPAVPKWSIKKWIGLPDETRPLILCEY
AHAMGNSFGGFARYWQAFRSHPRLQGGFVWDWVDQALTKKDENGTPFWAYGGDFGDTPND
RQFCLNGLVFPDRTPHPALYEAQRAQQFFTFTRVSTSPLVVDVQSDYLFRHTDNELLRWS
VTRDGTVLAKGEVTLSIAPQETQRLDISLPALTAEPGEVWLNVEVYQLKATPWSPENHRC
AWDQWPLPAPLFIAPPAPVGVPPVLTQTDEMLTLTHQQQRWIVDRTSGHLTQWLNNGVET
LLSPLTDNFTRAPLDNDIGVSEATRIDPNAWVERWKAAGMYDITPRLLRCEGEQHAREAV
VTTLHAWEHLGKALFLSRKVWRVDDQGVLHGEVEVEVASDIPEPARIGLSMHLARPPEAV
HWLGLGPHENYPDRKLAAQQGRWTLPLQAMHTPYIFPTENGLRCDTRELVLGTHQLNGQF
HFSVSRYSQQQLRETTHHHLLRDEPGYWLNLDAFHMGVGGDDSWSPSVSPEFILQNCQLR
YRFSWRQNLN
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatactgtctcgctgactctcagcgcacttctggcccgtcgggactgggaaaat
cccggcgtcacccagtggaaccggctggcggcgcatgcgccatttcatagctggcgtaat
gaacacgccgccagagaggacgcggcatccatcagccgacgttccctgaatggggagtgg
cgatttagcttcttttctgcacctgagcaggttccgcaggcatggacaggcgaagattgc
ccggatgccgttgcgatgccggtgccgtcaaactggcagatgcagggggttgatacacct
gtttacaccaacgtcacctatcccattcccgtcaatccgccctttgttccggcagagaat
ccgatcggttgttactcgctcacatttgaagtggaggacgcgtggctcgagggcgggcaa
acccgcattatctttgatggcgtgaactcggcgtttcatctctggtgcaacggtcagtgg
gtggggtattcccaggacagccgtctgccggccgaattcgatctttcgggcgtgttgcgt
gctggccagaaccgcctggccgtgatggttttgcgctggtgcgacggaagctatctggaa
gatcaggacatgtggcgcatgagcgggattttccgcgatgtgtcgctgctgcataagccg
gagacgtacatcgcggattatcaggtggttaccgacctcaatgcggagctggatcgctcc
gtgcttaaggtggatgtctccctggcgggcgctcactttgcggagtgcgaggtggcaata
acgctctggcgcaacggtgaacgctgtgccagcgccacccggcggccaggctcggccatt
gtggatgaacgtggcaactgggccgagcggttgacggtggcgatcccggttgcgtcaccc
gccttatggagtgctgagaccccagcgctttatcggctgacgatcgcgctgctggacccg
cagggtgaggtgctggagattgaagcctgtgatgtgggcttccgccgcgttgaaatcagc
aatggcctgctgaagctcaacggcaagccactgctgatccgcggggtcaaccggcatgaa
catcacccggaaaacggccaggtgatggacgaagcgacgatgcgtcgcgatatcgaaatc
atgaagcagcacaacttcaacgccgtgcgctgctcgcactacccaaaccatcctctgtgg
taccggctttgcgatcgctacggcctctatgtggttgacgaggccaatatcgaaacccac
ggcatggtgccgatgagtcgtctcgctgacgatccccgctggctgcccgccatgagcgag
cgcgtgacccgcatggtgcaacgcgatcgtaatcatccgtccattatcatctggtcgctg
ggcaatgagtctggtcacggtgcaaaccacgacgcgctgtatcgctggctaaaaaccgcc
gatccgacgcgcccggttcaatatgaaggcggtggagcgaacacggcggcgaccgatatc
atttgtccgatgtatgcccgtgttgatcaggaccagccgttcccggcggtgcctaaatgg
tccattaaaaaatggatcgggttgccggatgaaacccgaccgctgatcctctgcgaatac
gcccacgcaatgggcaacagctttggcggcttcgccagatactggcaggcgtttcgtagc
catccacgtctgcagggaggatttgtctgggactgggtcgaccaggcgctgacgaagaaa
gatgaaaatggcaccccgttctgggcctacggcggcgattttggtgatacacccaatgac
cgacagttctgccttaacgggctggtgttccccgatcgcacgccgcacccggcactgtat
gaggctcagcgcgcgcagcagttctttacctttacgcgggtaagcacttctccgctggtg
gtggacgtgcaaagcgattacctgttccgtcatacggataacgagctgctcagatggtcg
gtgacccgtgacggaacggtgctggctaagggggaggttacgctctccatcgcgcctcag
gagactcagcgtctggacatctcgctgcccgcgctgacggcggagccgggcgaggtctgg
ctgaatgtagaggtgtaccagctgaaggcaacgccgtggtcaccggaaaaccatcgctgc
gcgtgggatcaatggccactcccggcaccgttgtttatcgccccgcccgcaccggtgggt
gtgccgccggtactgacgcaaaccgatgagatgctgaccctgacgcaccagcagcagcga
tggatagttgaccgtacctcaggacacctgacgcagtggctgaacaatggcgttgaaacg
ctgctctcgccgctgacggataactttacccgcgcgccgctggacaatgatatcggggtc
agcgaggccacgcgtatcgatccaaatgcatgggtggagcgctggaaggcggcggggatg
tacgacattaccccgcggttgctgcgttgtgaaggagagcagcatgcccgcgaggcggta
gtcacgacgctgcatgcctgggaacatctcggcaaagcgctgttcctgagccgtaaagtc
tggcgggtggacgatcagggtgtgctgcacggtgaggttgaggtagaggttgcgtctgat
attccggagcctgcgcgtattggcctgagcatgcatcttgcccggccgccggaagccgtt
cactggctggggctggggccgcatgaaaactacccggacagaaagctggcagcacagcag
gggcgctggacgttgccgctgcaggcaatgcatacgccgtacatcttcccgacggaaaac
ggcttgcggtgcgatacccgtgaactggtgctggggacgcatcagttgaacgggcagttc
catttctctgtgagccgctacagccagcaacagctgcgtgagacaacccatcaccatctg
ctgcgtgacgagccggggtattggctcaatcttgatgcgttccatatgggcgtgggtgga
gatgactcctggagccccagcgtctcgccggaattcatcctgcaaaattgtcagcttcgc
tatcgctttagctggcgtcagaacctcaactga

DBGET integrated database retrieval system