KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01243Help
Entry
ECL_01243         CDS       T01231                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:enc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECL_01243
DNA repair and recombination proteins [BR:enc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ECL_01243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1279076..1279681
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLESETIKEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgctcacgcagttaatggaagcgttgcgctgcctgccgggcgta
ggcccgaagtcggcgcagcgtatggcgtttacgctattgcagcgcgaccgcagcggcggg
atgcgcctggcgcaggctctgacccgcgccatgtcagagattggtcactgtgcggattgc
cgtacttttaccgagcaggacgtctgtaatatttgctcgaatccgcgtcgtcaggagaac
ggtcagatttgcgtggtggagagtccggcggacatctatgccatcgaacaaaccgggcag
ttttctggccgctatttcgtgctgatggggcatctctccccgctggacggtattggcccg
gatgatatcggtcttgatcgccttgaacagcgtctggagtccgagaccatcaaagaggtg
atcctcgccaccaaccccacggtggaaggggaggcaaccgccaactacatcgccgagctg
tgcgcgcagtacggcgttgacgccagccgtatcgctcacggcgtgccggttggcggcgaa
ctagagatggttgacggcaccacgctgtcgcactctctggccggacgtcataagattatt
ttctga

DBGET integrated database retrieval system