KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01437Help
Entry
ECL_01437         CDS       T01231                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:enc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECL_01437
Enzymes [BR:enc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ECL_01437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1456088..1456702
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIIIEKQPPLVLLEVGGVGYEVHMPMTCFYELPDAGKEAIVFTQFVVREDAQLL
YGFNNKQERTLFRELIKTNGVGPKLALAILSGMSAQQFVNAVEREDPAALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPGAPVSDDDAEQEAVAALVALGYKPQEASR
MVSKIAKPDASSETLIREALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgttagtgctgctggaa
gtgggcggcgtgggctatgaagtccatatgccaatgacctgcttctacgagctgccggac
gcgggtaaagaggcgattgtctttacccagtttgtggtgcgtgaagatgctcagctgctc
tatggcttcaacaacaaacaggaacgcaccctgttccgcgagctgattaaaaccaacggc
gtcgggccgaagctggcgctggccattctctccggtatgtccgcccaacagttcgtgaat
gccgttgagcgcgaagatcctgccgcgctggttaagctcccgggcattggtaagaaaacg
gcagagcgcctgattgttgagatgaaagaccgctttaaaggtctgcatggcgatctcttt
acccctgctgccgatctggtgctgacttcgccgggtgcgcctgtgtcggatgatgatgcc
gagcaggaagcggttgccgcgctggtggcgctgggctataaacctcaggaggccagccga
atggtgagcaaaattgccaaaccggatgccagcagtgaaactctgattcgtgaagcgctg
cgcgctgcattgtga

DBGET integrated database retrieval system