KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01632Help
Entry
ECL_01632         CDS       T01231                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00040  Pentose and glucuronate interconversions
enc00052  Galactose metabolism
enc00500  Starch and sucrose metabolism
enc00520  Amino sugar and nucleotide sugar metabolism
enc01100  Metabolic pathways
enc01130  Biosynthesis of antibiotics
Module
enc_M00362  Nucleotide sugar biosynthesis, prokaryotes
enc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECL_01632
   00052 Galactose metabolism
    ECL_01632
   00500 Starch and sucrose metabolism
    ECL_01632
   00520 Amino sugar and nucleotide sugar metabolism
    ECL_01632
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECL_01632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DUF4833
Motif
Other DBs
NCBI-GeneID: 9124133
NCBI-ProteinID: YP_003612139
UniProt: A0A0H3CHS0
Position
1657154..1657966
Genome map
AA seq 270 aa AA seqDB search
MLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTSFELEAMLEKRVKRQLLE
EVQSICPPHVTIMQVRQGLAKGLGHAVLCAYPVVGNEPVAVILPDVILDEYESDLSQDNL
AEMIKRFDETGSSQIMVEPVEDVTAYGVVDCKGVNLEPGESVPMVGVVEKPKADIAPSNL
AVVGRYVLSAEIWPLLAKTPPGAGDEIQLTDAIDMLIEKETVEAYHMKGKSHDCGNKLGY
MQAFVEYGIRHNSLGEEFKAWLKESVGIKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttgccactggttgataagccattaattcagtatgtcgtaaacgaatgtatcgcggcc
ggcatcactgaaattgtgctggttacacattcatctaaaaactctatcgaaaaccatttc
gataccagtttcgaactcgaagccatgctggaaaaacgcgttaagcgtcagctgttagaa
gaagttcagtctatttgccctccgcacgttaccattatgcaggtgcgtcaggggctggcg
aaaggtctgggccacgcggtactttgtgcatatcctgttgtgggtaatgaacctgttgcg
gtcattctgccagacgtcattctggacgaatatgaatccgatctctctcaggataacctt
gctgagatgatcaagcgctttgacgaaacgggcagcagccagattatggttgaacctgtt
gaagacgtgacggcttacggtgtggttgactgtaaaggcgttaatcttgaacccggtgaa
agcgtgccaatggtaggcgtcgtagagaagcctaaagccgacatagcgccgtctaatctg
gcggtagtaggtcgctatgtcctgagcgctgaaatctggccactgctggcgaaaacgcct
ccaggagcaggagatgagatccagctgaccgatgccatcgatatgctgatcgagaaagag
accgttgaagcctaccatatgaaaggtaagagccatgactgcggtaataaactcggttat
atgcaggcattcgtggaatatggcatccgccacaattcactgggtgaagaatttaaagcc
tggctgaaagagagcgtgggtattaaaaaataa

DBGET integrated database retrieval system