KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01632Help
Entry
ECL_01632         CDS       T01231                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECL_01632
   00052 Galactose metabolism
    ECL_01632
   00500 Starch and sucrose metabolism
    ECL_01632
   00520 Amino sugar and nucleotide sugar metabolism
    ECL_01632
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECL_01632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1657154..1657966
Genome map
AA seq 270 aa AA seqDB search
MLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTSFELEAMLEKRVKRQLLE
EVQSICPPHVTIMQVRQGLAKGLGHAVLCAYPVVGNEPVAVILPDVILDEYESDLSQDNL
AEMIKRFDETGSSQIMVEPVEDVTAYGVVDCKGVNLEPGESVPMVGVVEKPKADIAPSNL
AVVGRYVLSAEIWPLLAKTPPGAGDEIQLTDAIDMLIEKETVEAYHMKGKSHDCGNKLGY
MQAFVEYGIRHNSLGEEFKAWLKESVGIKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttgccactggttgataagccattaattcagtatgtcgtaaacgaatgtatcgcggcc
ggcatcactgaaattgtgctggttacacattcatctaaaaactctatcgaaaaccatttc
gataccagtttcgaactcgaagccatgctggaaaaacgcgttaagcgtcagctgttagaa
gaagttcagtctatttgccctccgcacgttaccattatgcaggtgcgtcaggggctggcg
aaaggtctgggccacgcggtactttgtgcatatcctgttgtgggtaatgaacctgttgcg
gtcattctgccagacgtcattctggacgaatatgaatccgatctctctcaggataacctt
gctgagatgatcaagcgctttgacgaaacgggcagcagccagattatggttgaacctgtt
gaagacgtgacggcttacggtgtggttgactgtaaaggcgttaatcttgaacccggtgaa
agcgtgccaatggtaggcgtcgtagagaagcctaaagccgacatagcgccgtctaatctg
gcggtagtaggtcgctatgtcctgagcgctgaaatctggccactgctggcgaaaacgcct
ccaggagcaggagatgagatccagctgaccgatgccatcgatatgctgatcgagaaagag
accgttgaagcctaccatatgaaaggtaagagccatgactgcggtaataaactcggttat
atgcaggcattcgtggaatatggcatccgccacaattcactgggtgaagaatttaaagcc
tggctgaaagagagcgtgggtattaaaaaataa

DBGET integrated database retrieval system