KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01635Help
Entry
ECL_01635         CDS       T01231                                 

Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00010  Glycolysis / Gluconeogenesis
enc00071  Fatty acid degradation
enc00350  Tyrosine metabolism
enc00620  Pyruvate metabolism
enc00625  Chloroalkane and chloroalkene degradation
enc00626  Naphthalene degradation
enc00650  Butanoate metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_01635
   00620 Pyruvate metabolism
    ECL_01635
   00650 Butanoate metabolism
    ECL_01635
  Lipid metabolism
   00071 Fatty acid degradation
    ECL_01635
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECL_01635
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECL_01635
   00626 Naphthalene degradation
    ECL_01635
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECL_01635
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECL_01635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-GeneID: 9124136
NCBI-ProteinID: YP_003612142
UniProt: A0A0H3CKV4
Position
complement(1659816..1662494)
Genome map
AA seq 892 aa AA seqDB search
MAVTNIAELNALVERVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AYKIAELAGFTVPATTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAHFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYNEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTFYGREFKEGDVAAVKTEAPVIKADKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatatcgctgaactgaacgccctcgtcgagcgcgttaaaaaagcccag
cgtgaatatgccaatttcacccaagaacaggttgataaaatcttccgcgcggccgctctg
gctgctgcagatgctcgaatccctctcgctaaaatggccgttgccgaatccggcatgggt
atcgttgaagataaagtgatcaaaaaccacttcgcttcagagtatatctacaacgcctat
aaagatgagaaaacctgtggcgtgctgtctgaagacgacactttcggtactatcaccatt
gcagaacctatcggcattatttgcggtatcgttccaaccaccaacccaacgtctaccgct
atcttcaaatctctgatcagcctgaagacccgtaacgcaatcatcttctccccgcaccca
cgtgcaaaagatgcgaccaacaaagccgctgacatcgttctgcaggctgcgattgctgcc
ggtgcacctaaagatctgatcggctggatcgaccaaccgtccgttgagctttctaacgcg
ctgatgcaccacccggacattaacctgatcctggcgaccggtggtcctggcatggttaaa
gcggcatacagttccggtaaacctgctatcggcgtaggcgcgggtaatacccctgtagtt
attgatgaaacggccgatatcaaacgtgctgttgcgtccgtgctgatgtccaaaaccttc
gacaacggtgttatctgtgcttctgagcagtctgttgttgttgttgattccgtttatgat
gctgttcgcgaacgtttcgccagccacggcggctacctgctgcagggcaaagagctgaaa
gcggttcaggatatcattctgaaaaatggcgcgctgaacgcggctatcgtgggtcagcca
gcgtataaaatcgctgaactggcaggcttcactgttccggcaaccaccaaaattctgatt
ggtgaagttaaagttgtcgacgaaagcgaaccattcgctcacgaaaaactgtcccctact
ctggcgatgtaccgcgccaaagatttcgaagacgcagttgagaaagcagagaaactggtt
gcgatgggtggtatcggccacacctcttgcctgtacactgaccaggataaccagccagaa
cgtgttgctcactttggtcagatgatgaaaactgcacgtatcctgatcaacaccccggct
tctcagggtggtatcggcgacctgtacaacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccaaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggttctctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgtttcctgttcaacaacggttacgctgaccagatcacc
tctgttctgaaagccgctggcgtagaaactgaagtgttctttgaagttgaagctgaccca
accctgagcgttgtgcgtaaaggtgcggagctggcgaactccttcaaaccagatgtgatt
atcgcactgggtggtggttccccaatggacgccgcgaaaatcatgtgggtaatgtacgaa
catccagaaacccatttcgaagaactggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtaaaagcgaagatgatcgccgttaccaccacttccggt
acaggttctgaagttacgccgttcgcggtggtcactgatgacgcaacgggtcagaaatac
ccactggctgactacgcgctgaccccagatatggccatcgttgatgccaacctggtgatg
gatatgccgaaatcactgtgtgcattcggtggtctggacgctgtgactcacgccctggaa
gcctatgtttccgtactggcttctgagttctctgatggtcaggctctgcaggcgctgaaa
ctactgaaagaaaacctgccagcgtcttacaacgaagggtctaaaaacccggttgcccgt
gagcgtgtccacagtgcagcaaccatcgccggtatcgcgtttgctaacgccttcctcggg
gtttgccactccatggctcacaaactgggttctcagttccacatccctcacggtctggcg
aacgccctgttgatcagcaacgttatccgttataacgcgaatgacaacccaaccaagcag
actgctttcagccagtacgaccgtccgcaagcacgtcgtcgttacgctgaaatcgcagac
cacctgggtctgagcgcaccgggcgaccgtactgctgcgaagatcgagaaactgctggca
tggctggaaagcctgaaggctgaactgggcattcctaaatctatccgcgaagcgggtgtt
caggaagctgacttcctggcacacgttgataagctgtctgaagatgcattcgatgaccag
tgtacaggtgcgaacccgcgttacccactgatctccgagctgaaacagatcctgctggat
acattctacggacgtgagttcaaagaaggtgacgttgctgctgtgaaaacagaagcacca
gtcattaaagctgacaaaaaagcgaagaaaagcgcttaa

DBGET integrated database retrieval system