KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01725Help
Entry
ECL_01725         CDS       T01231                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECL_01725
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECL_01725
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECL_01725
Enzymes [BR:enc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECL_01725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1737555..1738364)
Genome map
AA seq 269 aa AA seqDB search
MERYDNAFAQLKSRQEGAFVPFVTLGDPGPEQSLKIIDALIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPTQCFEMLAAIRQKHPTIPIGLLMYANLVFNRGIDEFYAECAR
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDELLRQIASYGRGYTYLLSRA
GVTGAENKAALPLHHLVEKLAEYHAAPPLQGFGISSPDQVTAAIDAKAAGAISGSAIIKI
IEKNVDKPEHMLAELKAFVTAMKAATRKA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgataacgcatttgcacaactgaaatcccgccaggaaggcgcgttcgtt
cccttcgtaaccctgggcgatccgggcccggaacagtcgctaaaaattatcgacgccctg
attgaagccggtgccgatgcgctggagctggggatcccgttctctgacccgctggcggat
ggcccgaccattcagaacgccactctgcgtgcctttgccgcgggcgtaaccccaacgcag
tgttttgagatgctggccgcgatccgtcagaagcacccgaccattccgattggcctgctg
atgtatgccaacctggtctttaaccgcggaatcgacgaattttatgccgagtgcgcgcgg
gtcggcgttgactccgtgctggtggccgacgtcccggttgaagaatctgcaccgttccgc
caggcagctatgcgtcataacgtggcgccaattttcatctgcccgccaaacgccgatgat
gaactgctgcgccagattgcctcttacggccgcggttacacctacctgctctcccgcgcg
ggcgtgacgggtgctgaaaacaaagccgcgctgccgctgcatcatctggtagaaaaactg
gctgaataccacgcagcgcctccgctgcagggattcgggatttcatccccggatcaggtt
acggcggcaattgacgcaaaagcggcaggcgcgatctccggctctgctatcatcaaaatc
attgagaagaacgtggacaaacccgagcatatgctggctgaactcaaagcatttgttacg
gcgatgaaagccgcaacgcgtaaagcctga

DBGET integrated database retrieval system