KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01780Help
Entry
ECL_01780         CDS       T01231                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECL_01780
Enzymes [BR:enc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ECL_01780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1795245..1796930
Genome map
AA seq 561 aa AA seqDB search
MNDKIKNLINLVYGESFSEAHRETLSGKISRAAAVITERRKPGWDEKDIVLITYADQFYN
KGEKALPVFTRFYNRWLSRSFSHVHLLPFYPWSSDDGFSVIDYHDVAPETGTWQDVAELK
QYASLMFDFVCNHMSAKSQWFAHYLAQKPGYEDFFISVDPQTDLSAVTRPRALPLLTPFT
LDDGSVRHLWTTFSDDQIDLNFASPEVLIAMVDVLLHYLMEGARYIRLDAVGFMWKIPGT
SCIHLEQTHRLIQLFRAITDAVAPGTVIITETNVPHKDNVSYFGDGKNEAQMVYQFSLPP
LVLHAVHRQDVRALCQWASSLELPSKQTTWFNFLASHDGIGLNPLRGILPESEILSLVET
LQQEGALVNWKNNPDGTRSPYEINVTYLDALSAKKDEDTLRIARFILAHAVLLSFPGVPA
IYIQSIIGSRNDYEGVERLGYNRAINRKKYQAGEIDHKLDDINSLRHKVYSGLSALISLR
RQEKAFHPDSQARFETFGEHVLKIVRIADNGERITALFNFSNDIQHLPSNSQTGKDLITG
ININDTTLTLNPWQVMWIKEN
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgataaaattaaaaatttaatcaatcttgtttacggcgaatcgttttctgaggcg
caccgtgaaacactgtcagggaaaatctccagagctgctgccgttattaccgaaaggcgt
aaacccggttgggatgaaaaagatatcgtcctgataacctatgccgatcagttctacaat
aaaggggagaaagcgctgcctgtttttacccgtttttataacagatggctttctcgttca
ttttctcatgtgcatcttttacctttttacccgtggtcctctgatgatggtttttccgtt
atcgattaccatgacgttgcgcctgaaacgggaacatggcaagacgttgctgaattaaag
cagtatgccagtttaatgttcgattttgtttgcaaccatatgtcagcgaaaagccaatgg
ttcgctcattatcttgcgcaaaaaccgggctatgaagatttctttatttccgtggatccg
caaactgatttatctgctgtgacacggcctcgcgcattgcctctcctgacaccttttaca
cttgatgacggaagcgttcggcatctgtggacgaccttcagcgatgatcagattgacctc
aatttcgcctctcctgaggtgttgattgcaatggtggatgtgcttctccattacctgatg
gaaggggcgcgctatatccgccttgatgcggtcggctttatgtggaagatccccggaaca
agctgcatccatcttgaacaaacgcaccgtttgattcagctcttccgcgccattacggac
gctgtggcaccgggtacggtgatcatcactgagaccaatgtcccgcataaagacaacgtt
tcttactttggtgacggcaagaatgaagcccagatggtgtatcagttctccttgccacca
ctggttctgcatgccgttcatcgtcaggatgtacgggcactttgtcagtgggcctcatcg
ctggaactgccgtcaaagcaaaccacctggtttaactttttggcctcgcatgacgggatc
ggacttaatccgttacgcggaattttaccggaatctgaaattctgtcgctggtggaaaca
ctccagcaggaaggcgcgctggttaactggaaaaataaccctgatggtacgcgcagcccg
tatgaaatcaatgtaacctacctggatgcattaagtgctaagaaggatgaagatactctg
cgcatcgcccgttttattctggctcatgccgttctgttgagtttcccgggtgtgcctgca
atctatattcagagtattattggctcccgtaatgattatgagggtgtggagcggttaggg
tataatagagcaataaaccgaaagaaatatcaggccggtgaaattgatcataaactcgac
gatattaatagccttcgtcataaggtttattctggattgagtgcgttaatttcgttacgc
cgtcaggaaaaagcgttccacccggacagtcaggcgcgctttgaaacattcggggagcat
gttttgaaaatagttcgcattgccgataacggcgagcgaataacagcgctctttaatttc
agtaatgatattcaacacctcccttcaaatagtcagacaggaaaagatttaataaccggg
atcaatattaacgatacgacgttgaccctaaatccatggcaggttatgtggattaaagaa
aactaa

DBGET integrated database retrieval system