KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01932Help
Entry
ECL_01932         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00052  Galactose metabolism
enc00500  Starch and sucrose metabolism
enc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECL_01932
   00500 Starch and sucrose metabolism
    ECL_01932
Enzymes [BR:enc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECL_01932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-GeneID: 9124427
NCBI-ProteinID: YP_003612433
UniProt: A0A0H3CHW8
Position
1965098..1966504
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAVLQAVMKGQPRARADRHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCDHRYKCWGHWSSHDLLHWQHEPMALMPDEEYDRNGCYSGSAVDNNGMLTLCYTGNVK
FDDGSRTAWQCLAVEQPDGTFKKLGPVLALPDGYTGHVRDPKVWKHDGQWYMVLGAQDVQ
KRGKVLLFRSADLHTWESCGEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTYPAAWMSGAFDYQRGAFEHGELHELDAGFEFYAPQTTLAEDGRRILIGWMGV
PDGEEMLQPTRAQGWIHQMTCPRELRYRDGKLWQTPVRELEMLREEELHWQGNACDAPEL
DASRLEFELSAACAKLDFAGALHLTVDGNGLRLERASLQTGETLTRYWLGEVHHLRVLCD
RSSVEIFINHGEGVMSSRYFPDQPARVRFEGASDITLRYWSLRGCMVE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacattaccttcccgctggcctgccgtgctgcaggccgtgatgaaaggccaaccgcgc
gcgcgtgccgaccgccactacccgcagtggcacccggcaccggtgacggggctgatgaac
gatccgaacggttttatctggttcgccgggcgctaccatctgttttatcagtggaacccg
ctggactgcgatcaccgctataaatgctgggggcactggagttcgcacgatctgctgcac
tggcagcacgagccgatggcgctgatgccagatgaagagtacgaccgcaacggttgctat
tccggcagcgccgtggacaacaacgggatgctgacgctgtgctataccggcaacgttaaa
ttcgatgacggcagccgcaccgcctggcagtgcctggcggtggaacaaccggacgggacc
tttaaaaaactggggccggtgctggcgctgccggatggctacaccggccacgtgcgcgac
ccgaaagtgtggaagcacgacgggcagtggtacatggtgctgggcgcgcaggatgtgcaa
aagcggggtaaggtgctgctgttcaggtctgccgatttgcacacgtgggaatcgtgcgga
gaaatcgccggtcacggcgtcaacggactcacggatgcgggatacatgtgggagtgcccg
gacctatttgccctcgacgggacgcacgttctgatctgctgcccgcaggggcttgcccgt
gagccgcatcgttatctcaacacctatccggcggcctggatgagcggggcgtttgactat
cagcgcggcgcatttgagcacggtgagttacacgaactggatgccggttttgaattctac
gccccgcaaacgacgctggcggaagatggccggcggatcctgattggctggatgggcgtg
cctgacggggaagagatgctgcagcccacccgggcacagggctggatccatcagatgacc
tgtccgcgagagctgcgctaccgcgacggcaagctctggcagactccggtgcgtgagctg
gaaatgctgcgtgaagaggaactgcactggcagggcaacgcctgcgatgcgccggagctt
gatgcctcgcgccttgagttcgagctgagcgctgcctgcgcgaaactggattttgccggt
gcgctgcacctcacggtcgatggcaatggcctgcgtctggaacgtgccagcctgcaaacg
ggtgagacgttaacccgctactggctgggtgaggttcaccatctgcgcgtgctgtgcgac
cgctccagcgtcgaaattttcatcaaccacggcgaaggggtgatgagcagtcgctatttt
cctgaccaaccggcccgtgtgcgattcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgcggctgcatggtagaatag

DBGET integrated database retrieval system