KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02406Help
Entry
ECL_02406         CDS       T01231                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:enc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:enc00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2457742..2458512
Genome map
AA seq 256 aa AA seqDB search
MNLNGKTALVTGSTSGIGLGIARVLAKAGAQLILNGFGDSDAAREEIARLGKKPGYHDAD
LRDALQIDAMMRYADTQFGGVDILINNAGIQHVAPVEAFPVEKWNDIIAINLSSVFHTSR
LALPAMREKNWGRIINIASVHGLVASKEKSAYVAAKHGVVGFTKSLALETARTGITANAI
CPGWVLTPLVQQQIDKRIAEGVPADRAREQLLAEKQPSGEFVTPEQLGELALFLCSDSAV
HVRGAAWNMDGGWVAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgaacggtaaaacggcgctggtgaccggctcgaccagcggtattggtctgggc
atcgcccgcgtactggcaaaggccggagcgcagctgatcctcaacggttttggcgacagt
gacgcagcaagagaagagatcgcccggctggggaaaaaaccgggctatcacgatgcagat
ctgcgtgacgccctgcaaatcgatgcgatgatgcgctacgccgacacgcagttcggcggg
gtggatattcttatcaataatgccggcatacagcatgtcgccccggttgaggcgttcccg
gtggagaaatggaacgacattattgccattaacctgtcgtcggtgtttcacaccagccga
ctggcgctgcctgcaatgcgcgagaaaaactggggacgcatcattaatatcgcctccgtg
catgggctggtggcgtcaaaagagaagtcagcctatgtcgccgccaagcatggggtggtc
ggttttacaaaatccctggcgctggagactgcccgcaccggtattactgctaacgccatc
tgcccgggatgggtacttacgccgctggttcagcagcagatcgacaaacgtatcgcagaa
ggtgtgcctgcggatcgggcgcgcgagcagttgcttgcggagaaacagccatcaggagag
tttgttacgccagaacagctgggtgaactggcgctgtttttatgtagcgacagcgccgtg
cacgtgcggggcgcggcatggaatatggacggcgggtgggtcgcccagtga

DBGET integrated database retrieval system