KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02411Help
Entry
ECL_02411         CDS       T01231                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ECL_02411
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECL_02411
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ECL_02411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2462357..2462908)
Genome map
AA seq 183 aa AA seqDB search
MQSDILNTEVTTIDGDKTTLERYKGNVLLIVNVASKCGLTPQYEQLENIQKAWEKDGFIV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPMFSKIDVNGENRHPLYAKLVAAAPTAVA
PEGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgatattctgaataccgaagtgaccaccatcgacggggacaaaaccaccctg
gaacgctacaaaggcaacgtgttgctcattgtgaacgtggcctccaaatgtggtctgacg
ccgcagtacgagcagctggagaacattcagaaagcctgggagaaagacggctttatcgtg
ctgggcttcccgtgcaatcagttcctgggtcaggagccgggcagcgaagaggagatcaaa
acgttttgcagcaccacctatggcgtgacgttcccgatgttcagcaaaattgatgtgaat
ggcgaaaatcgtcacccgctgtacgccaaactggtggccgccgcgccgaccgccgtggca
ccggaaggcagtggcttttacgagcgtatggccagcaaagggcgagcaccgctctatccg
gacgacatcctgtggaatttcgaaaaattcctgattggtcgtgacggccaggtcgttcag
cgtttttctccggatatgacgcctgaagatcctatcgtcatggagtcaatcaagctggcg
ctggcgaaataa

DBGET integrated database retrieval system