KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02424Help
Entry
ECL_02424         CDS       T01231                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_02424
   01230 Biosynthesis of amino acids
    ECL_02424
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_02424
   00030 Pentose phosphate pathway
    ECL_02424
   00051 Fructose and mannose metabolism
    ECL_02424
   00052 Galactose metabolism
    ECL_02424
  Energy metabolism
   00680 Methane metabolism
    ECL_02424
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECL_02424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2473473..2474405
Genome map
AA seq 310 aa AA seqDB search
MVSIYTLTLSPSLDSATLTPQIYPEGKLRCSAPVFEPGGGGINVARAITHLGGKATAIFP
AGGATGEHLVSLLADEQVAVETVEAKDWTRQNLHVHVESSGEQYRFVMPGARLSDDEFRQ
LEEKVLTIESGSLLVISGSLPPGVSTEKLTALIRAAQQRGIRCIVDSSGEALQAALEPGN
LELVKPNQKELSALVNRELTQPDDVRSAAQELVRTGKARRVVVSLGPQGALAVDETGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLKLAQGAKLLEMTRYGVAAGSAATINQGTRLCSLADT
QKIVDYLSRN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtttctatctacactctgacgctctccccttccctcgattccgccaccctcacgccg
cagatttacccggaaggtaaacttcgctgcagtgccccggtgtttgagcccggcggcggg
gggatcaacgtggcacgcgccatcacccatctcggtgggaaagccacggcgatattcccc
gcaggcggagccaccggcgaacatcttgtctctctgctggctgatgaacaggtcgccgtg
gagacggtcgaggccaaagactggacgcgtcaaaatctgcacgtgcacgtggagtccagc
ggagagcaatatcgctttgtgatgccaggcgccagactgagcgacgacgagttccgtcag
cttgaagagaaagtgctgacgattgaaagcggttcactgctggtcatcagcggcagtctg
ccacccggtgtcagtacggaaaagctgacggcgctcattcgggccgcacagcagcgcggc
atccgctgtattgtagacagcagcggcgaggcgttgcaggcagcgttagagccgggcaat
cttgagctggtcaaaccaaaccagaaagagctgagcgcgctggttaaccgcgaactcact
cagccggatgatgtgcgcagcgcggcccaggagctggtgcgcacgggtaaagcgcggcgc
gtggtggtctctcttggcccgcagggggcgctggccgtggatgaaacggggtcagtgcag
gttgtcccgccgccgatgaaaagccagagcacagtaggcgcaggcgacagcatggttggg
gcaatgacgctaaaactggcgcagggcgcgaagctgctggagatgacacgctacggcgtg
gcggcaggtagcgcggcaaccatcaaccagggaacgcggctgtgttcgctggccgatacg
caaaaaattgtcgattacctgtcccgaaattaa

DBGET integrated database retrieval system