KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02466Help
Entry
ECL_02466         CDS       T01231                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:enc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2515570..2516211
Genome map
AA seq 213 aa AA seqDB search
MKQRALLLVDLQNDFCAGGALAVAEGDSTVDVANTLIDWCKSRGEAVVASQDWHPANHGS
FASQHGVEPFSQGELDGLAQTFWPDHCVQQTEGAALHPLLNQKAIDAVFHKGENPAIDSY
SAFFDNGHRQKTALDAWLRHHEITELIVLGLATDYCVKFTVLDALQLGYTVSVITDGCRG
VNIQPQDSAQAFMDMAAEGATLYTLADWLETQA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacgcgccctgttactggtcgatttgcaaaatgatttctgcgcgggcggcgca
ctggccgtcgcagaaggtgacagcacggtcgacgtggccaataccctgattgactggtgt
aaatcgcgcggtgaagccgttgtcgcaagccaggactggcatccggccaaccatggcagt
tttgccagccagcacggcgttgaacccttcagccagggtgagctcgacggtctggcgcaa
accttctggcccgatcactgcgtgcagcaaacggaaggcgccgcgctacatccgctgctg
aatcagaaagccatcgacgcggtgtttcataaaggcgaaaacccggctattgacagctac
agcgcctttttcgataacggacatcgtcagaaaacggcgctggacgcgtggttacgtcac
cacgaaatcaccgagctgattgtgctgggtctggcaaccgattactgcgtgaagtttacc
gtgctggacgcgctccagttgggttatacggtcagcgtcatcaccgacggctgtcgcggg
gtgaacattcaaccgcaggacagcgcgcaggcgtttatggatatggccgctgaaggcgcg
acgctgtatacgctggcagactggctggagacgcaggcgtag

DBGET integrated database retrieval system