KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02643Help
Entry
ECL_02643         CDS       T01231                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:enc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2683624..2685681)
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLSPKVAALLHGADYNPEQWENYPGIIEKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGEYDFAWLDNIIEKLYAAGIHIFLATPSGARPAWMSQKYPEVLRVGRNRVPALHGGRHN
HCMSSPVYREKTFTINRLLAERYSHHPAVLGWHISNEYGGECHCHLCQARFRDWLKARYK
TLDALNHAWWSTFWSHTYTDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTDFCRHEVAP
LKVANAELPVTTNFMEYFYDYDYWQLAKAIDFISWDSYPMWHKEKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPSTTNWQPTSKLKKPGMHILSSMQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHVGHLDTRVGREVTRLGEMLARLPEVAGCRTEARVAIVFDQQNRWALDDA
EGPRNMGMEYEKTVNEHYRPFWEKGIAVDVIDADGDLSDYALVVAPMLYMVREGFAERAE
AFVANGGHLVTTYWTGVVDETDLCHLGGFPGPLRKLLGIWAEEIECLGEGERNLIQGLAG
NAAGLQGPYQVRHLCELIHAESAQVLATYRDDFYAGRPAVTVNRVGKGKAWHVASRNDLP
FQRDFFAGIINELALPRAIEGELPPGVVATARTDGETTWVFVQNYTAQQQYIALPQGYTD
CMTDAAAAGDTALLPWDCRVLRRKA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcgcctttaagcccaaaggtcgcggcgttattgcatggcgccgactat
aacccggagcaatgggagaattatcccggtattattgaaaaagatattgccatgatgcag
caggcaaaatgtaatgtgatgtcggtgggcatatttagctgggcaaagctggagccgcgt
gaaggggaatatgattttgcgtggctggataatattattgaaaaactgtatgcggcaggt
attcatattttccttgctacgccaagcggcgcgcgtccggcgtggatgtcgcaaaaatac
cctgaggtgctgcgcgtcgggcgcaaccgggtgcccgcgctgcacggaggccgacataac
cactgcatgtcatcgccagtgtaccgtgagaagacattcaccattaaccgcctgctggcg
gagcgttattcacaccatccggcggtgctgggctggcatatctctaatgaatacggcggc
gaatgtcactgtcacctgtgtcaggcacgttttcgcgactggctgaaggcgcgctataaa
accctggacgcgctgaaccacgcgtggtggagcaccttctggagtcacacctacaccgac
tggtcgcagatagagtcccctgcgccgcagggagaagtatcgattcatggcctcaacctc
gactggcgtcgcttcaataccgcacaggtgaccgatttctgccgccatgaagtggccccg
ctaaaagtagcgaatgcggaactgccggtaaccaccaactttatggagtatttctacgac
tacgactactggcagcttgcgaaggcgatcgactttatctcctgggacagctacccgatg
tggcacaaggagaaagacgaaacggcgcttgcctgctacaccgccatgtatcacgacatg
atgcgtagcctgaagggcggtaagcccttcgtgctgatggagtcgacgccgagcaccacc
aactggcagccaaccagcaagctgaaaaagccggggatgcatattctctcgtcgatgcag
gcggtggcgcacggagcggattcggtgcagtacttccagtggcgtaaaagccgcgggtcg
gtggagaaattccacggcgcggttatcgaccacgtgggtcatctggatacccgcgtcggg
cgtgaagtgacgcgcctgggcgagatgctggcacgcctgccggaggtcgcaggttgccgt
accgaggcccgggtggcgattgtcttcgaccagcaaaaccgctgggcgctggatgatgcc
gaaggtccgcgcaatatgggaatggagtacgaaaaaaccgtcaacgagcactatcgtccg
ttctgggaaaaaggcattgcggtggatgtcattgacgctgacggcgatctgagcgactac
gcgctggtggtggcccccatgctttatatggtacgcgaagggtttgccgagcgggcagaa
gcctttgtggctaatggcgggcatctggtgacgacctactggaccggcgtggtggatgag
accgatctctgtcatctgggcggtttccctggcccgctgcgcaagcttctgggcatctgg
gcagaagaaatcgagtgcctgggcgagggggagcgcaacctgattcaggggctggcaggc
aacgcggcaggtttgcaggggccgtatcaggtgcggcatttatgcgagctgatccacgct
gagtccgcacaggtgctggcgacctaccgcgatgatttctacgcaggtcgccctgcggta
acggtcaaccgcgtcggtaaaggcaaggcgtggcatgttgcttcacgtaacgatctgccg
ttccagcgcgatttcttcgccggaattatcaacgagctggcactaccgcgcgccatcgag
ggtgaactcccgccgggcgtggttgccacggcacgcacggatggcgaaaccacctgggtg
tttgtgcagaactacacggcacagcagcagtacatcgcgctgccacaggggtataccgac
tgcatgacagacgccgctgctgcgggcgataccgctctgctgccctgggactgtcgggtg
ctcaggcgtaaagcgtaa

DBGET integrated database retrieval system