KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02969Help
Entry
ECL_02969         CDS       T01231                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECL_02969
   00500 Starch and sucrose metabolism
    ECL_02969
Enzymes [BR:enc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ECL_02969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3016480..3017763
Genome map
AA seq 427 aa AA seqDB search
MNISRISRLALALAFGVTLSACSSTPPDQRPSEQVAPGTASRPILSADEAKNFDRAHYFS
AMDPNAAPWTPSSINLPKQPNFVVGPAGAQGVTHTSIQAAVDAAITKHSASRQYIAIMPG
EYEGTVYIPAAPGSITLYGLGEKAIDVKIGLAIDSEMDSTTWRHLVNPAGKYMPGKPAWY
MFDNCQSKRAATIGVMCSAVVWSQNNGLQLQNLTIQNTLGDSADAGNHQAVALRSDGDKV
QINNVNILGRQNTFFVTNSGVQNTLQNNRLTRTLVTNSYIEGDVDMVSGRGAVVFDNTDF
RVVNSRTQQEGYVFAPATQSNLFYGFLAVNSRFNASGDGVAQLGRSLDVDSATNGQVVIR
DSVINEGFNVAKPWADAAISKRPFSGNTGSVDDKGNVQRNLNDANFNRMWEYNNRGLGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatttccaggatttcccgtctggcgttggcactcgcctttggcgtgacattatcc
gcatgcagttcaacgccaccggatcagcgaccttctgagcaggtcgcgccaggcaccgcg
tcccgtccgattttgtccgctgatgaagcgaaaaacttcgatcgcgcgcactacttctcc
gcgatggatccaaacgctgcgccgtggacgccgtcttctattaacctgccgaagcagcca
aactttgttgtgggtccggcaggggcgcagggcgtgacgcatacctctattcaggctgcg
gttgacgctgccatcaccaaacacagcgcatctcgccagtacatcgcgatcatgccaggt
gaatatgaaggtaccgtttacattccggcagcaccgggcagcatcaccctttacggtctg
ggcgaaaaagccatcgacgttaaaattggtctggcgattgattccgaaatggacagcacc
acctggcgtcacctggtcaacccggcgggtaaatacatgccgggcaaaccagcctggtat
atgtttgataactgccagagcaagcgtgccgctaccattggcgtgatgtgttctgcggtc
gtctggtctcagaacaacggtctgcaactgcagaacctgaccattcagaacaccctgggc
gacagcgctgatgcgggtaaccaccaggccgtggcgctgcgtagcgatggcgacaaagtg
cagatcaacaacgtgaatattctgggtcgtcagaacaccttcttcgtgaccaacagcggc
gtacagaacaccctgcagaataaccgtctgacccgtacgctggtgaccaacagctacatc
gaaggtgatgtggatatggtctccggtcgtggcgcggtggtatttgataacaccgatttc
cgcgtcgtgaactcacgtacccagcaggaaggttatgtctttgcgccagcgacacagtct
aacctgttctacggcttcctcgccgtcaacagccgcttcaacgcctccggtgacggcgtg
gcgcagctgggtcgctccctggacgtggactctgcaaccaacggtcaggttgtgatccgc
gacagcgttatcaacgaaggtttcaacgtggcaaaaccatgggctgacgccgccatctcc
aaacgtccattctccggcaataccggttccgtggacgataaaggaaacgtgcagcgcaac
ctgaacgacgctaacttcaaccgcatgtgggaatacaacaaccgcggtctgggtagcaaa
gtggttgctgagccgaagcagtaa

DBGET integrated database retrieval system