KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02969Help
Entry
ECL_02969         CDS       T01231                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:enc00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:enc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3016480..3017763
Genome map
AA seq 427 aa AA seqDB search
MNISRISRLALALAFGVTLSACSSTPPDQRPSEQVAPGTASRPILSADEAKNFDRAHYFS
AMDPNAAPWTPSSINLPKQPNFVVGPAGAQGVTHTSIQAAVDAAITKHSASRQYIAIMPG
EYEGTVYIPAAPGSITLYGLGEKAIDVKIGLAIDSEMDSTTWRHLVNPAGKYMPGKPAWY
MFDNCQSKRAATIGVMCSAVVWSQNNGLQLQNLTIQNTLGDSADAGNHQAVALRSDGDKV
QINNVNILGRQNTFFVTNSGVQNTLQNNRLTRTLVTNSYIEGDVDMVSGRGAVVFDNTDF
RVVNSRTQQEGYVFAPATQSNLFYGFLAVNSRFNASGDGVAQLGRSLDVDSATNGQVVIR
DSVINEGFNVAKPWADAAISKRPFSGNTGSVDDKGNVQRNLNDANFNRMWEYNNRGLGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatttccaggatttcccgtctggcgttggcactcgcctttggcgtgacattatcc
gcatgcagttcaacgccaccggatcagcgaccttctgagcaggtcgcgccaggcaccgcg
tcccgtccgattttgtccgctgatgaagcgaaaaacttcgatcgcgcgcactacttctcc
gcgatggatccaaacgctgcgccgtggacgccgtcttctattaacctgccgaagcagcca
aactttgttgtgggtccggcaggggcgcagggcgtgacgcatacctctattcaggctgcg
gttgacgctgccatcaccaaacacagcgcatctcgccagtacatcgcgatcatgccaggt
gaatatgaaggtaccgtttacattccggcagcaccgggcagcatcaccctttacggtctg
ggcgaaaaagccatcgacgttaaaattggtctggcgattgattccgaaatggacagcacc
acctggcgtcacctggtcaacccggcgggtaaatacatgccgggcaaaccagcctggtat
atgtttgataactgccagagcaagcgtgccgctaccattggcgtgatgtgttctgcggtc
gtctggtctcagaacaacggtctgcaactgcagaacctgaccattcagaacaccctgggc
gacagcgctgatgcgggtaaccaccaggccgtggcgctgcgtagcgatggcgacaaagtg
cagatcaacaacgtgaatattctgggtcgtcagaacaccttcttcgtgaccaacagcggc
gtacagaacaccctgcagaataaccgtctgacccgtacgctggtgaccaacagctacatc
gaaggtgatgtggatatggtctccggtcgtggcgcggtggtatttgataacaccgatttc
cgcgtcgtgaactcacgtacccagcaggaaggttatgtctttgcgccagcgacacagtct
aacctgttctacggcttcctcgccgtcaacagccgcttcaacgcctccggtgacggcgtg
gcgcagctgggtcgctccctggacgtggactctgcaaccaacggtcaggttgtgatccgc
gacagcgttatcaacgaaggtttcaacgtggcaaaaccatgggctgacgccgccatctcc
aaacgtccattctccggcaataccggttccgtggacgataaaggaaacgtgcagcgcaac
ctgaacgacgctaacttcaaccgcatgtgggaatacaacaaccgcggtctgggtagcaaa
gtggttgctgagccgaagcagtaa

DBGET integrated database retrieval system