KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03010Help
Entry
ECL_03010         CDS       T01231                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:enc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:enc00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:enc00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:enc00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3060137..3060484)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWEIWSGFFGSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAIRLPLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaacggcgtacatgacttcattctggtccgt
gctaccgccatcgttctcaccctctacatcatctatatgatcggtttcttcgcgaccagc
ggcacgctgacgtgggaaatctggagtgggttcttcggatctgccttcaccaaagtgttc
accctgctggcgctgttctccattcttattcatgcctggattggcatgtggcaggtgttg
accgattacgttaaaccgctggcaattcgccttcctctgcagctggccattgtcgttgca
ctggtggtttacgttatttatggattcgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system